Dataset for protein Bim of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                 r              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------MAKQPSDvsSECDR-EGrQLQpaER---PpQLRPG-----APTSlQTEpQgnpeg---gegdscphgs
a    dtsr mqslrp-nllggste-t--gg-gs---paq-s--t-r     --------r------nhg----------
      a k qh---- -f-d----vgpae-t-gvpa   s-ar-a-     s   khaqqsra qdgastavgrgsqsg
          snr nr a-q-eqggs qs-raa-t     fcpws s         i   -ceq dasredp rgslgm 
          d l  g rs nc e     s    d       f q e         r   y c   p p       gte 
                    k                                               e       i   
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pqgplap------------------paspgpfatrsplfif-rrssllsrsssgyfsfdtd--rspap-m-----scdks
-------dsdsppcsvs        ----------------m-------------------  -----p-sphpv-----
ggsrge                    n ldvyrs   i   v   rvpr         ese  sl ss l     tasaa
s r                       t  lg q    f        t            c      g  v     mhn  
                             s                p                                 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tqtpsppcqafnhylsam-----asmr--qae-------------padmr-peiwiaqelrrigdefna-yy-rr--l--
------------------avehgvrrlqs---nhystipphgaap----- ---r--------------l--a--vf-rn
     lts vms a qri ear gviiedesd l nhhna     asllf efv-vgldwyakssdyhhshspdtleklp
      sg  it l  s      dieegaigv g           sigwq r mvtprq lgs    yehlmqg mav l
                       -nwdhgsql             reath g sfwffk  v      n tft  eqr h
                        -ftmplep             lgncl s  qf            r sc   gsf r
                        ea-fehwi             grh   a  yy                   apa f
                        d-a q  g             ip       t                    ime d
                        lq  f                tv                             g   
                        ag                                                      
                         s                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
nyqaaedhpqmpimvilrllryivrlvwrmhrimymqgntsshdhsqv                                
hdsfspgnvrpvqlrlpvyivrliwrmhllqdrs r r                                          
padstgaqlmlhaqie pfmlcvclyrq vg                                                 
lkrpvslaacvqhyqv aa iw g  lr rr                                                 
srpenrp tv  rf      f  f  il  l                                                 
dhniide il  p                                                                   
qlychah h   l                                                                   
 sfrf                                                                           
   q                                                                            
                                                                                

       410 
....:....|.
           
-----------
           
           
           
           
           
           
           
           
           
           
© 1998-2019