Dataset for protein Puma of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vrlgeapgkplspgcgsgqrgpggagsggagrgggsrsrrrslsspalaspnclgadgcrragagggsgagrsvtsrgsr
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
garlqreaaaaaaaaepawepaaqdtcvrpagatagagagavasgggdrgggssssssssssssssrgssrgsggeqaar
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
sqappgrpgprltapqarprrrvhapgglgvglrsgecaprlgvrvpcrergplsprcccrcecgaglgklrrgrargva
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------cepglgsapacpcqvPr-a-
ppltcsahlsvslrrqapgsamararqegsspepveglardgprpfplgrlvpsavscglmkf-vpasrdamall--asl
               mp hwg    q d          p es  t   ss m      s i-csmap-q-s-tpargp- 
               l                      s                     -y-dan-vws-vr--aatv 
                                                            yla --rt-rprgar  gr 
                                                            w s gsqrg gh- f  cg 
                                                            v l c lgv           
                                                              g     s           
                                                                    e           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---sylwvpcqp-------g-------------g----------------------------------------------
apsaatca-taipavtaal-gprwpggprsrpr-prprrpaplsprppgalgsvlrplrarpgrrprrprpaarrlplrp
   -s-p-l---trqrrryspstpgrqapgpaaanqgq     paq      r         ac     h    c     
   tvv-payfmvwppelh qrlia alvwar  lgll                                          
   gtwflvpvccvwvstt lq ev  he ed   lf                                           
   flfswsgsa g sd s     r  s                                                    
    -  qg p                                                                     
    q     h                                                                     
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                       :*.  *   
-----------------cgpqPslslaeqhlespv---psapgalaggPtqaaPGvrgee-----eqwareIGAQlRRmA
hrptrrhrrpggpplawd-s--a-lp-q--ssgltlsg-a-----s--q----seglvp-hgpqspeqggtv pgd gpd
   a        f    ss-lg-p--rpare-agqegeg-taepm-ra-rpggd i--hpgsdgg-rgd-ql  ct pv 
                 -etr  arap-rq-a---warrqg s vtq  qspr  aas-d     r---qg    f  k 
                 p      g  spt  eraq hhgs   ie           pr       gs pa         
                 g      a   l                                                   
                            g                                                   
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              .      .*                                                         
ddLnAqYeRr-RqEEqqrhrpSPWRvlY--NLimGLLPlpRghraPemEPN-----------------------------
aadgglpqq-vvrasthqrhlt pllmeag--f---gafqsdrgt-dvtqgprsprdgaqlgactrpvdvrdsggrtlpp
-----r---t  ad epgaaap dttas  df-stm--v--rp-m al--- qg g              g l   p   
rr y - r s     gr pl a          lc    p  hna- --                                
         a      g                     -  a-                                     
                                         -                                      
                                                                                
                                                                                
                                                                                

       570    
....:....|....
              
--------------
pdtlasagdflctm
  a       f   
              
              
              
              
              
              
© 1998-2018