Dataset for protein Puma of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vrlgeapgkplspgcgsgqrgpggagsggagrgggsrsrrrslsspalaspnclgadgcrragagggsgagrsvtsrgsr
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
garlqreaaaaaaaaepawepaaqdtcvrpagatagagagavasgggdrgggssssssssssssssrgssrgsggeqaar
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
sqappgrpgprltapqarprrrvhapgglgvglrsgecaprlgvrvpcrergplsprcccrcecgaglgklrrgrargva
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------cepGlgsa--pacPcqvPra
ppltcsahlsvslrrqapgsamararqegsspepveglardgprpfplgrlvpsavscglmkf-vpasgdrma-all---
               mp hwg    q d          p es  t   ss m      s i-csmap-  q--vtpgral
               l                      s                     -yadan-v  wsghr--agt
                                                            yl- --rt  -   -ar  p
                                                            w s gslr  s   g f  g
                                                            v l c  g  v        c
                                                              g       e         

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
asytwvpca--p-------g-------------g----------------------------------------------
saalcaltqyfipavtaal-gprwpggprsrpr-prprrpaplsprppgalgsvlrplrarpgrrprrprpaarrlplrp
vpsvlpvp-  mtrqrrryspstpgrqapgpaaanqgq     paq      r         ac     h    c     
rtvsflslv  -vwppelh qrlia alvwar  lgll                                          
ggtwswrgs  ccvwvstt lq ev  he ed   lf                                           
 frfpsg p  a g sd s     r  s                                                    
 eq  q  h                                                                       
  l                                                                             

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                         :*.  * 
-----------------cgpqPsl---slaeqhlespvpsapg--alaggPtqaaPGvrgee-----eqwareIGAQlRR
hrptrrhrrpggpplawd-s--a-rprlp--------------tp-----q----seglvp-hgpqsprqggtv pgd g
   a        f    ss-lg-pgaa-arssggqlggrqgas  pmsra-rpggd i--hpgsdgg-egd-ql  ct p
                 petr  a   p-qqea teaeqathe   vtq  qspr  aas-d     r---qg    f  
                 g         arpppt ag  g s     i    al      pr       gs pa       
                 -          g  l        h                                       
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                .      .*                                                       
mAddLnAqYeRr-RqEEqqrhrpSPWRvLY--NLimGLLPlpRghraPemEPN---------------------------
pdaadgglpqq-vvrastpqrhlt pllmeag------gafqsdrgt-dvtqgprsprdgaqlgactrpvdvrdsggrtl
v -----r---t  ad ehgaaap dttas  dffstm--v--rp-m al--- qg g              g l   p 
k rr y - r s     gr pl a          lc    p  hn - --                              
           a      g                     -  a-                                   
                                           -                                    
                                                                                
                                                                                

       570      
....:....|....:.
                
----------------
pppdtlasagdflctm
    a       f   
                
                
                
                
                
© 1998-2019