Dataset for protein classical BH3-containing proteins of organism Xiphophorus couchianus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         :   .: **.:: :      **      . .. .:      *:  ::..   . ** *   * * .. *  
--------sntpptlsDGstevtpdvgtrGDpqssqrtprsssqthtstlPqlrsttvglqgrGEgE--vGtPtsgsP--
mltvtlcsmdrkfnil  esdpseaeeeg  lalmaekekplkhrerlra eagaskaeggag  e grr e dedf pc

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         **.**:  *                                  *** :.:  .. *.**: *. .*  :**
---------FRsRSlsrP----------------------------------PSL-tgqvynrqLrRMsvEhvnLllqGE
svspasldv  g  ifa trrsssgyfsfdcdslpssplsphpvtadkatqt   waakkmgha q  ad fgg gdk  

       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
  .* .  ..                          **:*: :                    . *  *
qtsVssppssr-------------------------PIyHsstw-------------------riSrtE
mrn lpdgpnetsttweqiavnigpvlfirpipmlv  h arslwsylfshqetegennhhenha al 
© 1998-2019