Dataset for protein classical BH3-containing proteins of organism Ursus maritimus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------p----l----------------------------g--p-----------------
meppqcvmmwsspefrpseqmshts-lsrn-slstflqsqlpevlsvphmtplvhyygp-ps-tsqqppgvqmrlafigd
       eelqievaqsrdgepgsq gdlg fadl a ehgdcp erlglfd teccd  lr ngnndkdtgkh      
        afedd  e e e ed g a                                      de dapa        
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  :      .                            .         
---------------gma--s-----n--g-rgvl-----pssypagtpl-eq----------------ppe--ca-r--
tqtvrwplqrvmlpq---mypsrvty-qt-ywlsvqprerrpqsrslan-s--teqwsrstfrnrsssleasvs--l-yg
rmsppsmspgaghlp vtks-qdlssgnhrlg q lsgsphapmdpaletrlnlriqellp  g glda  pmpwqksae
eleaagl ge ae c qpeq laff ehd ga p e a  a ll g   eg gi eedf            nleadiq  
                  ae       ca e  a         f      d                     gc  h   

       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
                           .                                       
----------------lprpqpqsnatrv-ls-----lv-sww-tpl-----------------p--
vqlrrmsqeiqgsfkrtrttsspqtssqmy--pswtw-is---rsntflhnlalnadeprggsg-sq
reia kldcfadq hg qmqkhklrqrnksqnapplrv-rrllqrl            nadpaa rd
                 hafgdagqfn hrd  mdagt qkhfeig            g a    h 
                       c  f cl         e   dca                     
© 1998-2019