Dataset for protein Bmf of organism Tarsius syrichta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDPSQCVEELEDDVFQPEDGESGTQSGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRHTSQEDKATQTLSPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************. *      * *. .. .:    *  :*                         ..:*:*.*  
GVMLPCGVTEEPQRLFYgpAg-----PkShvvgltllptqPrgqW-------------------------rrqQnRnRs-
                 an eyrlpl a fpaadpfgeqp efe qhraevqiarklqciadqfhrlhvqqhe e g mw

       170       180    
....:....|....:....|....
                        
------------------------
wqilfflhnlalngeenrngagpr
© 1998-2018