Dataset for protein classical BH3-containing proteins of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------mqpsqcveeleregfqpep-------------gepgtqprrvaptplvqsrl-cpl-r----p---------g
mgrprmakespdvss-cdddvgglqelsrlvpsavscgl--------p-sad-f---q-d---s-lqlf-lssgpthcc-
 fqipqp--------spak--le-sg             a rpprlq-g---s-qte-qgngegegdrcrqlgpagspqv
 aiaenfssartstgg---st--s--             w elvpsg srsqlatsgmfqi ttprseteg f  rwgl 
     eegr egplqartsrlprrkt             p   lgra r hgg saaycpa qh qevqad    prag 
       e   ehd  is gaamag              c   g a  a     p    c   f pa l a    dp a 
           aea   r      f                                      a                
            a    i      a                                                       
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
p---pts--------------------------------dkatatlspaspsqgvmlpcq---vt---------------
-glr---qepfatrsplfifvrrssllsrsssgyfsfst-rppqpmccdkst-tps--sggar--eepqrlfygnagyrg
rlapgrgpg w                  fgrsgcc dss-s-------a--aa--ps-- klafnhss saaakfrll 
 sst  der                            tgtl-qprfget-rrr-cyvq s    rglg  p  htmeag 
 rpq    q                              rtglgsv aggqqlltpr  a     sr       hg    
  n     a                              gg   ha  cehp eswa                       
                                        d   a     ah  ql                        
                                                      g                         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   .            
-------------------gfpsglplgeqppegqwqhr----------------pevqiarklrrigdefnrly---mq
lwrpgvataltqvllplpa-rlarmatqtnsqrepadpdlspfrgrslsappilwaaiwcgqefqcma-qlha-hkglpr
           krgfaempsyr-a-nsmra-tavalpm-                wgqeyviqassvstk---y-   r-
              pvstrh--m-r-----ed---e-es                s rrtrar kal  - qqsf   -w
              arr k ls sysepsea-ist-e-q                  lls mg   g  d airt   e 
                    ah ns a a  l rrr  l                   k   a         g       
                        k      g lg   e                   h             f       
                        g                                                       
                                                                                

       250       260       270       280 
....:....|....:....|....:....|....:....|.
                                         
rvqqnqnrvfwqitl----l---------------------
qhmlfslppwsphl-plhn-alhgdenrngagprpsqrrnl
krsnlia---rlg-sfppyiiswllryvarlvawmqgpn  
-lla---klr---prwtywvwmrwypqsrarawplme    
p-f-stytappssw vkrmpq gaaalpg g  ael     
 k-prnrqqmlgpa   qf   c    i             
 iteg qfhafa                             
 e  e i f e                              
          a                              
© 1998-2019