Dataset for protein Bmf of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********************************************************************   .    * 
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQhqqnqnrvWw
                                                                      efps---- l

       170       180   
....:....|....:....|...
                       
qillflhnlalhgdenrngagpr
g----------------------
© 1998-2018