Dataset for protein classical BH3-containing proteins of organism Seriola lalandi dorsalis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------------------f----
mkaqadgaalfiqqttkpvrwldrsngkrgerrgsttrrcrwspgakpqferqrraetiatspgnslgvfqmrsn-tysr
                                                                       kaai sipd

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ...    .: .              :* * *  *                                  ::  .:  .  
sssepyfvfdsdsmswsttsreqktsqRtTqTp-Ptlr--------g-a-----l---------vrphhfqrvgeqeagt
redsgsesvepgplptrplgqrpelee h l ls esqlnngmlpc-v-tgrtr-nygshtstvsmkeelelradehgrr
md  edde  e ehcq l fp iacad g    g a a         a keprp fsenagfrlhfdaa  am    g

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .*     .  . .       **:*. :.*:*                     . .  .*              
qtsgqqrrGr---srsqpvarwvakkyGQkLrrigDqFn-ll-----r---------qrrhspswW--------------
prmqepqn meqlpkqfasglsqeecv  e qlms e hs--dkgem-kvlslytqnlmnvgklr rvcvcvcvcacgcv
age aefh e   h ha p dma aai         d dr        ehkqaghak lh  hh  claaal        

       250       260       
....:....|....:....|....:..
   . : .     * ..          
---sylfsrvrveGggghve-------
calglvcghqltc ennghrrhthrte
  c c  dcgeia    ag n      
© 1998-2019