Dataset for protein classical BH3-containing proteins of organism Sarcophilus harrisii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          : . : .  .  * :      *:              :                             .  
--------mfqisefep--sepGeqpsastaPslaplrpgpraapgaqhhentg-----------------------atr
mesphyvmelepdvlnseddre gdlqptes tqpqqsqpdytsiqthyqplshegdscspsspqgpfapptspspfcqk
       eak d d h  c    a  ggl r a fa    apmld l lfgkg                         gg
                                                   ga                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.                          .    : :  : :  .                :    .    :          
srlr----l----------------regsreaspeaeaeaeqseg--------eeerglfrgrsssappi----------
pqtivyvr-spslsrsssgygsfetsvsqepmatqtstqtsspqcvmlphyvtamptrsmyqsqgyrldmpanfpsslrl
 p hsspprkalapqgrl kf  dgdr padk cdklsp pp p qafncgls  dha    na ipa l          
 g fifke                                                                        

       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
           *   . . :*. :.*:*:                : ...    . :          :          
-------lwaaR---hygseLrrmsDeFhctfkglprpksagtasqmrrshvwtrtlqsw----fgrnlgkgsvgps-
gaeppee---- pevwiark qcig q n---------rnnyqrhdqnqqmgiwqlflylirlvwrmq---------h
       q eh a iq  q     a    asyprrgfldlhm  a dhhn   l i hfihn aln eenrnga  r 
                                                                              
© 1998-2018