Dataset for protein Bad of organism Sarcophilus harrisii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************************************** .** ...      *                ********
MFQISEFEPSEPGEDPSASTAPSLAPLRPGPRAAPGAHHHEkgGAqrsrtivyppL----------------REGSREAS
                                         ga  gkpqlhsske kasasqgrlgkgsfeg        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PEAEAEAEQSEGEEERGLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTFKGLPRPKSAGTASQMRRSHGWTRTFQSWF
                                                                                

       170   
....:....|...
*************
GRNLGKGSVGPSH
             
© 1998-2018