Dataset for protein classical BH3-containing proteins of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              .                                                 
--------------------makqpsdvssecdregrqlqpaerpp------qlrpga----------------------
mkcgmgsawacpcqmfqipe--pseqqdvesledg--vstaedsevgsgkhr-----sllsadlfaqslldcplsrlqlf
              vprassfeme--ecpgkapsdlspfshgrgvd      rtq sl                      
                    lt--se-mcl sailsltplclqf a      gqa  -                      
                      wv c r   q  kmeae    a                                    
                       m       k    a                                           
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
Ptslqtepqgnpegnhggegdscphgspqgplappaspgpfatr-----------v----------fdtdrs----papm
-lthshgqg----s--------------s---------------splfifvrrss-lsrsssgyfs----g-kgwrrl-v
 gdaccq--qrtt-sedkatqtlspagr-qgvmlqcgvteepqdvsyvqleasqpyvvgvytprlpygna-ygrre--sl
 ------gtlpaseqrhsgeswaeerenhsar sdpatisyqrhtfnrprrplhlwrhata agyfqsrr teimdvsea
  amevv  sd p vp evnppvrtm kansg aallndqdem leklkadlkec ea p    taaill qd l se -
    ag    a   d    agapkml h lr    d caa    aa aa   a               ee d    e  s
                        ci a d                                              d  g
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
scdkstqtp---sppcqafnhylsam-------asmr-------------------------------------------
pfsfqarrqlgep--egqwqnlgrglwvsgtss----qsqaepagmrpeiwiaqelrrigdefnayyprrvflnnyqarg
-agvpwvllqhrqst-rllysraevqfeatkqavafklevvadqmwllhvqqhlqnynrvwwqvllflhnlawsgeenae
v-arvseskgdk-nnw---srwims-dc  g  lrrsrqcidssfhsrrsstlgtatqyrqssswtrviqsyvprnlgsn
tv-prrdqh   ldivwvhremshks       ivlpmlirvlllgpnkprsffk  gmhh  gteq  hkwkdpd  q 
qprihpaff   eafsakgld  aer       rpwleghqlifkffgglkl  d               is        
l  gfl  a      r  ag     e       kliiddflc eee af f                    e        
e  aee         l                 giee  ag                                       
               i                  d d                                           
                                  c a                                           

       250       260  
....:....|....:....|..
                      
----------------------
ghppmvilrllryivrlvwrmh
daghrqfrcv            
 stqsp                
 la i                 
                      
                      
                      
                      
                      
© 1998-2019