Dataset for protein classical BH3-containing proteins of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              .                                                 
--------------------makqpsdvssecdregrqlqpaerpp------qlrPga----------------------
mkcgmgsawacpcqmfqipe--peeqqdvesledg--vstagdsevgsgkhrgtq--sllsadlfaqslldcplsrlqlf
              vprassfems--ecpgkapsdlspfsqevg ltmevvgrqa sl                      
                    lt--dr-mc dqlmlsllpehlrd a      --- e-                      
                     mwv cpl   ka ktaae  f a         sd  e                      
                      s        i      c                                         
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ptslqtepqgnpegnhggegdscphgspqgplappaspgpfatr--------------------fsfdtdrs----papm
-gdhshgqg----s------------------------------splfifvrrssvlsrsssgy-----ag-rlpr--s-
dltaccq--qrtt-sehkatqtlspagrsqgvmlacgvteepqstrnvrlealypwrvgvptlrlfygr--ykgwlsl-v
 ------ tlpas qrdegnswaeer kasarqsdpltdqyevhrqkrq dqshe aty agaaypqsntetgrmersef
 pasvgd l a p v    epevrtn hhlsg a dinasmdrdlealk a  e   h      tilaprdqe l ek s
    ae             agapmml d nr     aa      aa                    a el i    de c
                       k i a                                         e d       a
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
scdkstqtpsppcqafnhylsam-------asmrqs-a------------------------------------------
pfalpprrqpselwwrqrlevgideatgssvrll--q-epagmrpeiwiaqelrrigdefnayyprrvllnnyqaagghp
--vgqlgelqgvgrvqhkagwqr       s-f-reivdqfhwlhvqqhqlnrnqvwwsvllfllnllfngeenrnedgt
va---rlvagdtwnqlydqqrsl       lv-wmcvtvsswrsrkssvlgtaygyrqqsswtrhiqayksrnlgs asa
tvrpvsesr anvglhsnminl-       -pkseglssilmvpnrpktffd tamllaqgtgqvhhswwppd  r  l 
l gir dph  ksefgr fame        rkwpddhrcgelgfgf fs  a l lhh mfseg   ksvd    q    
e eeh ahf  gid ag   hd        kiiic gqa  ke a  a                   ie           
   a        fa  a   e         geef  fg   e                                      
                    a          d e                                              
                               c d                                              
                               a                                                

       250         
....:....|....:....
                   
-------------------
hmvilrllryivrlvwrmh
rsqfrcv            
qip                
p                  
                   
                   
                   
                   
                   
                   
© 1998-2019