Dataset for protein classical BH3-containing proteins of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------makqpsdvssecdregrqlqpaerpp---qlr---pga----------------------Ptslqt
mkcgmgsamfqipe----mqpsqcveelgdspstagdseqgsgktqrqa--sllsadlfaqslldcplsrlqlf-lthsh
        wacpcqfepseeed--saqskldvfssergme   gh-spvfvl                       gdacc
              vpra----wv--mmcsa p lsla a   --lceq s-                       -----
                  s ltpgpka        dil     t e     d                        amev
                     m  k                  h                                  ag
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
epqgnpegnhggegdscphgspqgpla-p------a-r--------------------fsfdtdrs----papmscdkst
gqg----s-------------------p-aspgpf-t-splfifvrrssvlsrsssgy-----ag-rlprrls-pfalpl
q--qrtt-sedkatqtlspagrsqgvmlqcgvteepqdvsnvqlrasqpyrvgvytprlfygne-ykgwl--ev--vgvr
-gtlpaseqrhsgespvetrenhsag sapatisdqmhtekrkwellilwqlatmadgypasy-etgrmess-fva-qrp
v  sd p vp evnpapkmm kans    l cda    aa lard ehgaeh ra adtnqqrr re l eq stvrpqs
    a   d    ag a el h d                    a ae           a ipl q    dk cl giiq
                  c                                          al  d     e ae edh 
                                                              e              a  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qtpsppcqafnhylsamasmrqs-a-------------------------------------------------------
rrqpgelwwrqrlevqivr-l--q-epagmrpeiwiaqelrrigdefnayyprrvllnnyqaagghphmvilrllryivr
gelqdwgvlqhkagwlr--l-eeivdsfhrlrvqqhqlnrnavwwsvllfllnllfngeenrnedgtrsqfrcv      
lvagavvnvysdqqrglsvkdrcvgsqswwshrvkvpgtwlqyssqsswtrhiqayksrnlgs asaqip          
hsh  tsgqhrlmmns-rkfwmhttvimlvngkpftlfdaygmrqaqgtgqvhhswwppd  r  l p            
epf  nrefgg iahe piwsgdrspglkpf f asf a t lll mfseg   ksvd    q                 
d    kid aa f gd kfpidal  e el     c      khh         ie                        
a    gfa      e  geifc g    ag                                                  
              a   dee  f                                                        
                  c                                                             

      
....:.
      
------
lvwrmh
      
      
      
      
      
      
      
      
© 1998-2018