Dataset for protein Bmf of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************. *      * *  .. *     *  :*... *   :                          
GVMLPCGVTEEPQRLFYgnAgyrlplPaSfpavlPlgeqpPegqWqhraEvqiarklqciadqfhrlhvqqhqqnrnrvw
                 ap e----- k cvvag plpaq gfe rrkq wgrse-------------------------

       170       180    
....:....|....:....|....
                        
wqvllflhnlalngeenrngagpr
------------------------
© 1998-2018