Dataset for protein Bad of organism Saimiri boliviensis boliviensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
**************************************************************   : :  .. .:     
                                                               ag a  ha       

        90       100       110       120       130       140       150       160
                               .  *       *  *       *.        .                
atdseaqhtenvq-e-sh-wrv-vatary-qsrl qgrmerl sp ggrresh aplglgqhmahgrrrmsdefvdsfkg
       daaklk d le vlh      t a ee de l ee al aahpara  niaaagdl aelkcfl         

       170       180       190       200    
lprpksagtatqmrqssswtrviqswwdrnlgr  stqsqfrcv
                                q  lapip    
© 1998-2019