Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------makqpsdvssecdregrq------------------------
msgvrpvsrdilmetllyeqllepltmevlgvtdpeed------------ed----erglrpspagdrvpsavscglikp
                                      lfqirefepepq--dssarlapglfcl rl         cef
                                       dmeeqrcvl lpvsvlm d    a i  e            
                                        rm deg   eme  d                         
                                        pa   d                                  
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-lqpaerppqlrpgaptslqtepqg------------------------nped--nhggegdscphgspqgplappasp-
g-sdsgkahrqaq-s---a------llwdashqqeqptssshhggttpv----rl------------------------g
 p--edgh-gaq r-slr-dlfapsvidaqtgprwpvltrfrprfprlkgtqssrslapltlesgvplrptsqegkstqa
 fmv--aer--v pkyacspawvsaqty lgddirdggp  md  agadenlpahwyyeqhhcmspnparraspdgprsr
 vgstr-- knm l kvamnsqglpf c                     cart fqsf aetgeqehmteemkllsgagm
 mdagp c c l a e  kh l ac  a                     t im adq    s ddl fsa k  fr   l
  a  l   a         a g                             g         i      e     ea    
     k               a                                                          
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pfatrsplfifmrrssllsrsssgyfsfdtdrspapmscdkstqtps-ppcqafnhylsamasrrqaepa----------
------------------------------pk-r-e---e----r--s-wr---------l-l-------dmrpeiriaq
tpgpagseeqvalpigvtlepqrldynaqle-r-v-aap-qqrr-reqg--vlyqsrmgl-v-plltsgpesernlsvgi
slpvtvesqgwygeclaqearmadflavgya pqqvyevtavwhqttksdtrvweliwevrpawpghravtqimraqtrg
aa sqlwra rl al rrmservvleqpav- lglktdtpptqplqrflaqptprwwsqtqlvknesavtqcfhg hsqd
n  and a      e   aldnlsgslnlgy a  cs gqlrlmig    kls aqkrlrniriksqvssh d a     
                    algkeggl ew    al f eig       egq  pfgdn gpfifeciq          
                     efh  fk  l         ca        aen   daa   neg d  k          
                           h                        c         i e c             
                                                              g d               

       250       260       270       280        
....:....|....:....|....:....|....:....|....:...
                                                
------------------------------------------------
elrrigdefnayyarrvflnnyqaaeehpqmvilrllryivrlvwrmh
tsqwrnrvwwqlllyllwkylnsstqrtgalprrdfs           
hqlnf ft tgieefvhsnwpdhhsndne gnh               
f   c  i h fd   mnipiagee                       
                 e l                            
                 c a                            
                 a                              
                                                
                                                
© 1998-2019