Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------makqpsdvssecdregrqlqpaerppqlrpgaptslqtepqgn
msgvrpvsrdilmetllyeqllepltmevlgvtdpee--------------d----erglglspagdrsslrarlhr---
                                     dmmeiprfvpseqe-sssf--ekkerknqqpp-d-gkafasap
                                      lfpmeeceerled d vaml-d-aag-a---fal-dh--lsl
                                       d     malarq   dp  v- ---i- emd-  --vle v
                                             d   cm    m       rd     v    p a t
                                                               c      p    g   q
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----nhg-g-gdscphgspqgplappaspgpfat------sp----mr--s-lsrsssgyfsfdtdrspapmscdkstq
pedvr---l-e------------------------rtlgpr--lfif--rs-l-----------a---l-s-v--a----
ldtplsplvslaqlwdlthqreqplssthqpgktaqetrsawwsypvslpcgvtpeprrlsyal-eqs-r-v-ps-qvll
ssglimrs astlafqasvccaygtraswhedvilvlnim hsyqgagterderesgqqpflrvrsyhaevtawtppgar
ageackqa  rlriy qqltirkvst fmv ftgck g   f gg res e pnmleppspeqsqgrnpgpqydrqeryp
 cc aef   a pgm clfda dkcl  ad cq  a     a        d  gadaemhe gp vpk  lnl peaiwg
     d      i a  hd      a     aa                         g a  n  m    cd f     
     c      f                                                  g  l       e     
                                                                  a       a     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tpsppcqafnhylsamasrr----a------riaqelrrigdefnayyarr-----------------------------
------a-------------qaep-dmrpei--------------------vqlnnyqhaeehpqmvinrllryivrlvw
aglqtq-ewwsdsqtlllwpgvrseetqwgretgaqwtwmaqdlhrrreylrfkeqqraspspwrvlyllimgllplprg
rtglrletqvvlgllgvwknetagvtepravqrtttsqcfpftwwqqqlqvlsiapshsrwttsslnhrdfsngeenrn 
qlerlpsgnrrhefk gvillevvkpcitqm qsss l vfas tglnvpqhleyrnsvwqqillgg   a         
lea  mfdllqg ah  rfi dkt g aa l crrk   s  q gffhkl pwtwllfctmdae f              
i    a  efke     pee              kg   c  p  dae g nesskd  dga                  
         e       n d              if      k    d   mcqpia                       
                 i                d       i        ganlg                        

         
....:....
         
---------
rmhpemepn
hrar     
agp      
         
         
         
         
         
© 1998-2019