Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  .                             
-----makqpsdvss-------------------------ecdregrqlqpaerp--pqlrpga----------------
mepsr----------qpedgepgaqpgsslsadlfvqsll--plq-p-fmsltqadsssa----qedkatqtlgpaspsq
    mcveelvsdvfpmpvllyerllprptplvrlatdpvdd---r-e-faskkecg-g-lqtsylcap appavtaalg
     sivrregsdrle teglaqdgeplfmeg g p aes mfsilrae gphcedr-qicpp                
      grfgqerai                         a ldpveg s t wv   kna a                 
        a   g                             gccm d d   cm   dm                    
                                             e   a   a    c                     
                                                          a                     
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----ptslqtepqg-----p----nhgg-g---ph-s--gplappaspgpfatrsplfif-rr---lsrsssgyfsfdtd
gvmlergvtps-a-drpsn-edhl--a-e-dsc--g-pq---------------------m--ssl--------------
 prw-crare-c-rpemddsgkahrq-pqhlesqvplapplvydgstqqeqgvsgsehqwateieaqllrwayplnaqye
    rpnpg-r ra    vaqtsrsl elsyvmmlsftraakwgaphdaapvltpeheggthlvgvrmapmyddaqveva
    qla -sg i     t lr pfy qa irl  hasl killste ksrpeqdfmg  qgak tii hrlqeigt fs
     k   la       g  p  d  n  ega    gf ff aq d iri  a   d     a n a fkghcees eh
     g   a                                        d                  a     ad d 
     a                                                                          
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rspapmscdkstqtpsppcqafnhylsamasrrqaepa-m-p--------------------------------------
------------rrrnawrvlyrlq--ll-l-------d-r-eiriaqelrrigdefnayyarrvflnnyqaaeehpqmv
errqeypvqqqrhs----an-weaimg--v-pllsravelernllwrptvlwattpttrrrlyvwwrypaswwqrtlprp
qnmvcvmteerw--tgrv--vs---vytrpvlnehavpvgglrgqtkigsktfpfirqmlqtssltkvlqpstddregln
 gesarhsatispqmeqkwwt-qslsqnilrwigevtntdsfl  pgdf asc  hqggedskgnsisidhhsaana  g
 a l lelpfhqanlalgstqrlrfrngagnngmtnslsciak  l         a fe   hcmr pf  fg       
   e e    al lf d pffiake l  ekifcdgrkka  h                      e l            
           g g    lee  ed h   ife  dnfg   g                      a              
                    d          ed   l                                           
                                    e                                           

       250      
....:....|....:.
                
----------------
ilrllryivrlvwrmh
stspsqsdmaassgg 
lsdgqh          
hraf            
                
                
                
                
                
© 1998-2018