Dataset for protein classical BH3-containing proteins of organism Rhinopithecus bieti

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------makqpsdvssecdregrqlqpaerppqlrpgaptslqtepqg
msgvrpvsrdilmetllyeqllepltmevlgvtdpeed--me--r-----edd------ldge-ggqrpsssradlraa-
                                      lf--tefcve l---ssvfrge---r-adqmkdlgkhafqvs
                                       dqiew-epl qmes daema-gpsca-mgadvalrahqlsp
                                        pr dsd         m l grla knae  kga nppg q
                                        em                  kk  i           g   
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--e------g-gdscphgspqgplappaspgp-at------sp----m---s-lsrsssgyfsfdtdrspapmscdkstq
np-darnhg-e---------------------f--rtlgpr--lfif-rrs-l-------------y-l-l-a-fpqvl-
lldv mcplsrlqlfdlthcceqglrsthqedktlqetrsahwsqgvglpcgvteepqrlfygnag-sar-t-w--a--p
tsgt  hsa laliwqasfqrrkpts smh gtgav nim fsyypaeteedenpserpspervrsan-qvqleve-ryr
 a    dq    igy qhdti dv t f d fa  k     a      s d  gmlaemhe qsqvr pgsny taeiwl
            f m    d   k l                            a   g a ag  m   pev rqca g
                                                                  l    cd e     
                                                                          a     
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
t-psppcqafnhylsamasrrqaepad------iaqelrrigdefnayyarr--l-------------------------
-g----egqwq-raevliapk------mrpeir-------------------vn-nlyqeendnpqgvrlrllryivrlv
ireqlla----s----qvr--lqcigtqfhrlhvqshqqnrnrvwwqillfllfkanngaaerhgampirltwnllrlqt
rllrrm-envvqsslg-lvwletsav ptrmrqtgiwtlwfafwqtrrrryvhwspqqshtqstwrvnypdisgggpcpr
qetlgdsltlslkfqt wnknvsvvt ciqg  ssgts vptsrlfgqdphpssiyshrsspassgllhn fm       
l rf  kdl rgg kn pliirktsp a g    rdqr smqpigdenag grtelpdhdra pe               
a  e   ae kde hl gkfgfeggk        kaf   c  h a l   cnqagia  m                   
          e d     iee da                   f   e    me e                        
                  g d c                              a                          

       250
....:....|
          
----------
wrmhrlmepn
llrgpe cl 
ghka      
          
          
          
          
          
© 1998-2018