Dataset for protein classical BH3-containing proteins of organism Rhinopithecus bieti

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------makqpsdvssecdregrqlqpae
msgvrpvsrdilmetllyeqllepltmevlgvtdpeedmfqipefepseqedsssae--me--rcve-leds--vfrqgd
                                      ldpmed d l cmeertwsrgl-lg--gdr---drk--mlep
                                                  lad dm l -g apa--ppsv-l hhg  k
                                                           as  claa mvag  rs   q
                                                            r  ai   g     ap   i
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rppqlrpgaptslqtepqgnped--nhggegdscphgspqgplappasp---at------sp--ifmrrssllsrss---
ge-gaq--sslradlfas-----pt------------------------gpf--rtlgpa--lf------------qvyl
-ar---qp---gflydrtsqldqvrcslsrlqlfqlthccrkglrstgqedkenqsermspfsqgvrlpcgvteep-rlg
k-qknamsrran iwrqrhlqrtalspshh gttlvetts hwyy set es gpeae laersrslsapptvwlar   
lsevrmhalg a  aglertig   tqfml igmakhnrr fssl   s  d  m       agag n gaqdaae    
   l             adde    d a d fag   fim ak                            n        
                    a                                                           
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------sgyfsfdtdrspapmscdkstqtpsppcqafnhylsamasrr-------rpe--ia--lrri-d-f--------
rllrrl----------l-------a--p-ge---eg------------qaepadm---ir--qe----g-e-nayyarrv
ae llmrlfygnagyg-wlcavfp-vl-i--qwp--qwqhsqtlvlwnltrvvtspaqvqtrrksqcfafqlhrlhvqqh
      ahevvvsvll rr y tteqwrrtrrrtvtwtrvpgswgvplepvssscisnsemgtt lwc  t tqrqlyll
      genlqlqlk  lv g ks prhqqmlqsssyrssmapfwriighagpeagrhldc is gg   k  gfeklvn
       dlekggfh   k   aq i a     rkl elif l pnfeag al  eqg    dq      i  f de  m
       a   deaa          g       a     d    lied e  k         af                
                                             da  d                              
                                             a                                  

       250       260       270       280       290  
....:....|....:....|....:....|....:....|....:....|..
                                                    
----------------------------------------------------
qlnrnrvwwqillflhnlalngeenyqgagdrpqmvilrllryivrlvwrmh
fqyklfcsgt              prnatepheltwnrgrsqtllkgrlmcl
wkw                     ldsssq t  lnhgdfc           
sip                     iahh                        
lnl                                                 
e a                                                 
c                                                   
a                                                   
© 1998-2019