Dataset for protein classical BH3-containing proteins of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 starqrsv-mitvt- akdd gifp pqg-hevrgcqtvvlasqka-aqeavtwvsqpgsslqlgppqgccdrgrs vp
 prrkpqrseigntlv           asfm dqgsqrrcqa  lw-p-p-ylsqteplddpcphfal aa ag ar sl
 gmp lpgrd ekdkq            e l  hcegpdae    likelfgflnpag c   a            g  g
  ge amcmc ahah               a  f    a      a g k ecgdl c                      
  e   eal   e d                  a             f i     a                        

        90       100       110       120       130       140       150       160
qrsqpglfiapgllglisqqqp qaafdsvldiqt--sts-gnssyrras                 arqsssetparap
had                          pkrttsvrpqrh-krwqkatr                 eppqqidslsapg
f                            hhagdgtmelmgshqmm  gm                 clmfhf rge lf
                                  f ldel  dk a   g                  igeg   f   e
                                     aae   a     a                  edae   e   d
                                       a                            a      c   a

       170       180       190       200       210       220       230       240
                                :   :                                           
--vqs-eitrrglwiqvret    eigaigpsmgps teli-nlqrwqvattdyqvsesstqmqvfssvqnilp prdph
pqrprt-fpniadsqnlgaq         flnfsgq h---vgipppksqnqstwqrqprsstrmypmwplv l nggew
llpllstdlma  kacee p          ac  ak farfsa   g rhmpgahmnpfqdpiilinhfmg  a l  ag
ekaeepa ag   g  ad             a   g e q k      l gea  hg  la g f lf l          
 g acd   a                         d              e    g   a                    

hggle n   
© 1998-2019