Dataset for protein Bim of organism Pygocentrus nattereri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              :.:.  .*  ****************************************
----------------------------rsnragrpaFlkEQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITMPNS
llsarkarfsvcpcsspedrihhlpmyr-mqnsnycc --                                        
                         hsl                                                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************:*        *** .* :                **************
LLGYQSRSPLFRTLSRSSSGYFSFESEPSSPLvThsastqtpSPSsqVithalqriaeargnaqtfELWPLYNHHPPHGA
                                l --------   ls cst---------------              
                                                                                

       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
******************************...  * *              .*      .   ::   
APAGDMRPESYVAQELRRIGDEFNELYFHGvsqlhGcVagmq----------aLsnrvllsv--lfrrs
                              agrng r qlpaeeepafmlwlg vipraheqlgmlalr
                                                       a d fdi     gh
© 1998-2019