Dataset for protein Bad of organism Pygocentrus nattereri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:: :                                                           .*:*: ** : :.*.*
Msnqytq---------------------------------------------------------sDeSnwSEtvkngDsP
 ahmfllklrrarfnceeerykkviktltgekgtpfnplcwnslrttacamekhsedgistmddq d dt  dlgda q 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: ... .:: *.  *  *: : *   * .  .*. :        :*.* :  ..**.** .** *..***.*** *****
qlssrhsms-SnqsPlvPerlsEvrqRvrsysEsqv--------qEsGlvrhggGAgDGdsFRrRsrSAPpALWkAKKYG
eadkqaelaq gih as defr sgc nhlmn dalytvsrwqdn d alaedd  a  ap  g cq   a   a     

       170       180       190       200       210       220   
....:....|....:....|....:....|....:....|....:....|....:....|...
****.******* **** .* *::....*  :. .**:***. **.:.               
RQLRrMSDEFDTwLDKGmtR-RssspgrQ--tsrsWFtFLWssKEsesre-------------
    k       l    dk v aagaak mhanpg  s   gh  edgeasssltapdtrpae
© 1998-2019