Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------makqpsdvG----secdreggqlqsverppqlrpgaptslqtepq-
msrvrqvstsplpvtgmepshcvpelledvsqpe-ge--tqp-rgpp---------qsqadcalsrlqlfslt------g
 fqippegsdlemeefpfrhlprespedvlfssgd--sg-ps     cvlsadlfa-gllcagrkq--a----hgcgsgl
 aea e          laedgle liqgrsvpmdvspglm--     aleasssvrgrprstcdenvg-tykrtcqplsa
                     fd fe     iaareln lkr         cpe paphprs acmtapslhqqrdaips
                                  nccc dhf           a   ma pk  afa dr fcapa  he
                                       ce                k  ki          a     e 
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------p-g-------r-sh-sp-gp-appa--g---------p---r--l---------l-r-
vtrqlqgpwwvmgprsrprgpn-e-sregegd-c--g--q--l----sp-eepqptqya-fat-sp-fifvrrssl-s-s
smaafgaerapl         ritsqqdsltqtlrpaespvgvmlgcgvt   grlfarsgvrgpeewwareigaq rtm
        p dg         shp pepkaslaeqllwysqmtehsllae   s frggnasyqevrqavqvadrp gsq
                     h h gaglvltss  s l a s ede ma         lsgppln pssfpy pe pel
                       d     cer p              l           redk    gh    l     
                                                             ca                 
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
s--------drs------------papmscdkstqtpsppcqafnhylsamasmrqfrae-a------------------
-sgyfsfdt---qiarklqciadqerrrwesqqrrrq----vlytlimpll-l----q--p-dprpeiwiaqelrrigde
pdelqwqnnaqy            fptlqrrrrghswvrwr--w--v-g--p-ptlv-gpememnkrrnl          
acdf  ehsrev            vleirvqllqsprnfqwwsllt-y-wwlarnghvvgshwllg              
 a g  a rfkk            rha pleehpdnlicmssq-erfwqsrwvnlegpsvl psq               
        l               qe  hkaaglakih aqpei q ilrfvrlivenrng l                 
                        gc   i  e    g  pk   a akn rdkg lifla g                 
                                a    a  ag      h  c gc  g i                    
                                         d           ea  a                      
                                                     a                          

       250       260       270       280
....:....|....:....|....:....|....:....|
                                        
----------------------------------------
fnayyprrvflnnyqadedhpqmlilrllryivrlvwrrh
        mp psd                          
                                        
                                        
                                        
                                        
                                        
                                        
                                        
© 1998-2019