Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------makqpsdvg----secdreggqlqsverppql
mararqegsspepvmsqvrpvstplpmgtlvpshvsepliqevlssap----mlpshrgppcvealtddpfrtrdggsgt
              eglipegprdfllerfpfealldgselpgspimgrgpn-ekr-    al-essa-v--pec-eger
               fea d               fc  ce d  a dnelmlvhka    --snpqsv-tvlaataesq
                                                aceg m f     yrk cppsrgk---s-dpm
                                                   c d a      g  adepaaghpsliacf
                                                   a              ac       i   e
                                                                           e    
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rpgapts---l---pq--p--s-----------sp-gplapp-s----atr-------------sp----vr-sglllrs
qa-svr-adl-qte--gn-eg-regegdrcshg--q------a-qgpf---eepspfrgtlspa--lfif--rls-esh-
--l-slrwwvfaqsqlpq ssrlqeqhllsplthcrlaglrgttpedpgvq        rsrsdgesqwwalp--v-eer
wgdtl-qrprgprpdgdc ll sahg aefvvpraphswygap maak me           c q eeqvmqeiqdt--p
v ar-ka    ghi         h    glcer sc  s   m ehsl la             p vrgg   c aqpqa
t  q h                      d             g    e                  nl a   y tk g 
l  g f                                                                     r    
c                                                                               
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ssgyfs-dtdrspapmscdkstqtpsppcqafnhylsamasmrqfqae--------------------------------
--d---f-----rqe-wrsqqrrr-----vlytrvrpll------r--padmrpeiwiaqelrrigdefnayyprrvfln
mr-fyqaqyenrvltl--eaglhpwvrwrp-weqimg--plrslv-gpemepnrrrvqqhqqnqnrmwwqillflhnpap
qaldlnqnlyklqrrrpsrvv---rlqta-s--l---wwlapnglvviahwllklhnl                  ml l
lmrq anksreyipkpkkprtpslqicqssgqw-ryqsvwvalvhpsgsdqsqg                          
   g g epldmg  ifihleap ig aqgel thwlrrvrlikgifvl pfh                           
   e e agf k   a faga d ge  pec  a ieqerikceegcl  l                             
         a            a  a   d      ae qgea  a                                  
                                       cd                                       

       250       260        
....:....|....:....|....:...
                            
----------------------------
nyqadedhpqmlilrllryivrlvwrrh
sgeenrngagpr                
 d                          
                            
                            
                            
                            
                            
© 1998-2018