Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------makqpsdvg----secdreggqlqsver--------------
mepsmcverleddvfqpedgesgtqpgpvlsedlsssg-----aqsqrgppl--alsrpa-fpltsccaptappavtaal
    hsrveqvstsplmvtfpfrhllrssplavsfpmdvspgl-p--    -dsp-aal-q-lachls            
     fqipp gsdle  e laedgfe liqgr viaargln m-r     ave-s---rgv----f             
     aea e                d fe        neec lkp     cpa ppsvp rhrsy              
                                       cc  dhf      l  cde c l pat              
                                           ce       g    c   k g i              
                                                             g                  
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------ppqlrpgaptslqtepq----gs-eg-l-r--h-spqg--------------------paspg---------p
ggpwwvlg-g------hq-g-q--gppe--r--e-d-cv-g----plapnagyrlplpasfpagl----aeepspfrgr-
   r pgad-statsqedk-p-tlsnssslqgvmgpspstseypaltyg                stgm-         s
       mavmlgrrs--qaqpssasalpgadqheecgrpealgrmfgh                dlqaq         l
         skk dknrpp d lh  mrqf asv t s law   game                 eelr          
         rf  aglkid       hh    lc r           ea                  dek          
         e      aa              e                                    e          
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
fatrsplfifvr----l-r-sdg--------spapmscdkstqtpsppcqafnhylsalasmrqfrae-a----------
------------rssl-s-s---yfsfdtdr--rrrwreqqrsr------lytlvmplm-l---vqgpp-dprpeiwiaq
svrqpeewwareigrq rsmasdl  ennaqye--lqesrg-r-qvrwrv-w-qi-ln-papllh--gememnkrrnl  
gsvgevrqaeqqcaak qclg qf  a srkkvpt------qhqwncqwws-q--yg-wl-knggvv-shwllg      
rpgpwrprpvepy le g i  k     lfefgleipvrlhp-pri mssqlltkw-wrwvrieessvl psq       
hedatqhlgt            e          h  hqqaelanig apphierfiqs vrngv-prtg l         
aca dnae                            eka a    a  age  a  hr idlcfrnfna g         
                                     i           d         c ea li l            
                                                             a   g i            
                                                                 a              

       250       260       270       280        
....:....|....:....|....:....|....:....|....:...
                                                
------------------------------------------------
elrrigdefnayyprrvflnnyqadedhpqmlilrllryivrlvwrrh
                mp psd                          
                                                
                                                
                                                
                                                
                                                
                                                
                                                
© 1998-2019