Dataset for protein Bmf of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************. *  .    : . *. **  **.                      * * . *:. ..*    
GVMLPCGVTEEPQRLFYgpAgyr----ssvvAgpPLptQPc----------------------FhRrrvQqrqrsQ----
                 an epklplpahfp dl  ge  aegqwqhraevqiarklqciadq e lhe ehgqn nrmw

       170       180    
....:....|....:....|....
                        
------------------------
wqillflhnlalngeenrngagpr
© 1998-2018