Dataset for protein Bim of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQgnpegsregegdrcshgspqgplappaspgpfatrsplf
                                         ---------------------------------------
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ifvrrssllsrsssgyfsfdtdrspapmscdkstqtpsppcqafnhylsamasmrqfqaepadmrpeiwiaqelrrigde
--------------------------------------------------------gvvv--------------------
                                                   vreieeif                     
                                                                                

       170       180       190       200
....:....|....:....|....:....|....:....|
                                        
fnayyprr--l-----------------------------
--------vf-nnyqadedhpqmlilrllryivrlvwrrh
        mpkpsvpsi                       
        la cld                          
© 1998-2018