Dataset for protein Puma of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        : *  :* *.*. :*.: :.               .*  *
---------------------------------------mkpGlpsArAcPcqvPgtyls---------------wWvlG
mararqegsspepveglardgprpfplgrlvpsavscglcef aga p a all aasfcaptappavtaalggpr pg 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        .  *********************************************************************
--------rppGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
prsrprgphid                                                                     

       170       180       190   
....:....|....:....|....:....|...
*********************************
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
                                 
© 1998-2018