Dataset for protein classical BH3-containing proteins of organism Pongo abelii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
  maqiegfpsqeq esermmr-vs-mhpkrrvs---yqq-lr sqm acshqqeaplslsyhr-ltvvttssrhkpmqs
       eee ec  d adaemelg lelekqsptsvphhrfg aea    aap   f aa cgva lteireeedaded
                    akc e i g idpknrsleg e   a                 ep   rdal dd     
                     f  c g a damg   kcd c                             e        
                          f   c       a                                         

        90       100       110       120       130       140       150       160
la seypqstmllgssr--ts         apsyqnlnyyssqrvmpgrprpsrrvl-vssqstywwfqrqqttrvgals
f  mapmk rlgde pgtrlr         rapckeihlrmhlmtam qleggqmqgrtrmlglngpalqdilqe   kg
   l alg ped c maadaq           f gcf h  da s l  a   dlaapsaeh egea ehaeeed   ff
   a  de            p               a         f       f   i aa       c c a    e 
                    l                                 a              a          

       170       180       190       200       210       220
dkynf dniv-s-s-rlqrqrmaglalmqrqsrsvtvsy qimhlrn ngehrrngme n
aa la  k taniqtgkpqgq     ilmnip p rsmh  flgd a g  en  ea   
       e n l kaahenek        h n l  qlf                     
       d a g h  fdh h        f       i                      
       c     e  ece                                         
© 1998-2019