Dataset for protein classical BH3-containing proteins of organism Poecilia mexicana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   :..        *      : :        .                               
----rppnlldgstevtpaegvggdpassaRtprsskhterscapqagpsta----------------------------
mhsl----------mseesddtfe------ gnlrlmqvker------alsqggggggggggrgepdsdsppcsvspasl
    mdakftisdsded e   e pdpncw   fqeikc d gtqtp  gq                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     ..   *   :      :   .          .      :.                       :   .    .::
----srsifrPprrsssgyfsldcdslpssplsphpvtadkatqtpspt---------------gglglhghspnhystl
dvfrrhtltl elvattpr-rfnygnigftlsreehlqlvgefevrtqegqvmnhalqrmaveheqnrmrqrpnsqppsi
    l ngm  cg  ee  v  fse aa rihf aefe r dedagq                   fpfe l lha a

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           *.:*. :.*::     .  :.       *                          :       *  .  
naar-----nfGrqLraigDdy----nnhlmrmarrhqrN-------phiqqepvwwlcvclllslvgrimymqGntssh
wlekdmqseky qk qrms qfvnllhrghlqqysstgs ivplnlmr----srsam-------lylfsrqfte gnnhg
s  a     ci     l       dkee  kvqqn          qp hhg l  rmtaa      hhgeia egg

        
....:...
 .      
dhsqv---
rr---rte
enhas   
© 1998-2019