Dataset for protein classical BH3-containing proteins of organism Pelodiscus sinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    : .*:  :.:     ** :::: . *           :.* .  
------------------------------------mppPsyleseys---GLdeevllspD-----------ysLtgqp
mgragrgpgaaqsvqaprrvpafcpvaggseraaarfda agadedrrsld  addlfhed sllfrqslsasfg dagk

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:  ..     *.. .   *.** :         .  .*   ::: **.:. .:* ..***    **             
GeqtptqpstqNssysgllGrFQsi------qltrpggPtsrqtqyQDrstvtmSpssSTQtvspPCq------------
 dmmakgifdl qecdceg q  lferpsqpphlhcca giihaeq  kapqpl cdk   dpml  gvteepqrlfygn

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            *:* :*.   .:.*          :: ..*:.**.:*. *.*:*:  :  *     :*  .:*:  .:
------------AlNpyLsemprqgH----------qemrpEvwIArkLrrIgDqFnrsyiqR-----nQqnrnQvwwrl
agyrlheppvgf f hh qaegked asrwespsiredaqa iq  qe qc a e halhcp rgfldh ainh ivlqi

       250       260 
....:....|....:....|.
* :: .*  .::         
LlylirLiwrvq---------
 hfihn alnmeanrnhigqr
© 1998-2018