Dataset for protein classical BH3-containing proteins of organism Paramormyrops kingsleyae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           . :           *.  :   ::  * :.    :         *       *    .  .   .   :
----------msqvtytppftvssnEsrtt---esrtP-vvqqtqm-------kvPgqvgqtpRrstyssvss-yhspdl
mddddddvfhtgpllmqimcsiikc nkisrmaqtpn dltensplqnnprtt-n cglqgrv mrslgqsglrlrflai
           dgi lah  rdcga ddg      dg a aaglnigaglkna l  ea ae  flfe aa  gi  e  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
..                 .*   .. .                         *   .    ..:*. :.*:*     . 
sv-------------pgpntPfrtrsrstr-----------------------PqpwaevrygrqLrrigDqFnt---ng
dlgeggaseegggvc--ghs qmghqpddqtpspsnhlvciylssvtrtlsml dmspaqlvaqk qmms k hqlyikq
 f               dgp  ee nk ap                        alr  m i  e      e ddildd 

       170       180       190       200       210      
....:....|....:....|....:....|....:....|....:....|....:.
:.         .        :      ...:                         
vsryrspqrprqp--mrqvptltpylwsrkqsesqr----s----r----------
mqlvlrnhcnqr-vwwqlsmswfglpgenrnrdeplssss-wlhv-mgqveqqeiv
lkilhcagaal  ta gagaa caf fdh ekaaeirgrl tads aae       
© 1998-2019