Dataset for protein Noxa of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
*******************                                         * :*: * .   :. :  :*
                   gqagtagtardqagfgigmqlhftrskklvsssplalprgh ee ec rqlrcfgdkeif 

        90       100       110       120       130   
*.               * ** *.  * *                        
 kelpaetsesdsqtll l  i kkf i glqkrlflrrctlhqfeerlhcnw
© 1998-2019