Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------makqpsdvssec------------------dregrqlqpaerppqlrp-
msgvrpisrdilmetllyeqllemfqipefe--eeedscva--glgpwvrssisqptasrlspaddkpsdsgkhhrqaal
                       pmtpfvlgpsm---r--errssrtllpmqdcgmqpll elpqkvfrkedgesgaqr 
                        limepvhvt-pcp-sd-msdgdlgecceaadll a  -ml heahvnaqarptlq 
                         ckcg  sgrg ecrcpceafa               lai  lmdqvtsw  r   
                               r da  aq   a                  kc    e  rpm       
                                      l                      a         l        
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------gaptslqtepqg--e----g--------c----------------p----
sevamhslglgllwdashqqeqptssshhg----------r-np-gnhg-eglfplds-phgspqgplappaspg-fatr
          afiy qtddirdvlr fmd fsslyadlfa-slldcplarlq    thaggpglrptsqgrsatqtlppa
                               tawqsavwtsersssyastte    edecmeeepssfredkrsavsgnl
                               r   gspge ahhaqwprkmr    lq sl vsvqlhltqrklrd svt
                               g    ps v  gq nts eil    ae  f mgm  efl gmkl  nsq
                                          ee ad   a         a i a  a     ad   ap
                                          d                                     
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
sp----mr----lsrs--gyf---tdrspapmscdkstqtpsppc--qafnhylsamasr-q--p---------------
--lfif--rssl----ss---sfd-p-----rg-p-----r---swv-wqq---------r-ae-admrpliriaqelrr
wasqrvglpcrvveepqrlfyrkglytlrlva-f-talpw-rsspetr---swwvrilrllssiadssggehlqqhqqnq
yeargyteeqgttrdefvdswgnag-qaqvk-earavwmmgqqt-qgsvrrrledqnvgkgecatsqflritvrrttcml
l tpsehqqlvrmpvnwlvlstspvwl ltekdvgrykglleaqapfnslhaarrlltnwktvlgllvhwfgqlpkr h 
f rdpqephalqrlskrmr gnrisrk  c larelteei pfgdksgretvp pptsvsilevvg qk  ff lfg d 
  p  ga   en klgi c  kqeng     g p cq  e nea clefaal  nnrrlqhdlm v     a  fc    
           h a  h    apcma       l  p    c     d   k  lg gkifcdg                
                a     l i        h       a     a      a   ife                   
                        f                                 aed                   
                        e                                   a                   

       250       260       270       280       290
....:....|....:....|....:....|....:....|....:....|
                                                  
--------------------------------------------------
igdefnayyarrvflnnyqaardhpqmvilrllryivrlvwrmhlsvqpe
nrvwwqillfllnlklsseenengvdpryktwrgsvrk kassf  ck c
yehrhsqvwwqhmwappg qe g     p nan a               
f ehlrentep ls dfd                                
     hcdq   eh a                                  
             e                                    
                                                  
                                                  
                                                  
                                                  
© 1998-2019