Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 cpckaripme--rcv--lsddv---e-gspraqggsmlsadl--q- -dc-lsq-----lsshhqpglrpesrersswy
    pshkna-srpt-aqarl--trg-vr-qegf ig ql ftfsks v--v--aeglfl-thccdgavavttqsmralr
     lgvr-i  --rm ---yaqlftl-tma c         s ak tsssvp-  dldrmeef vtssrsrvghldad
       rgrg  ail  tlqs ik  ald                   lartlp     p  d   qecm e d     
         p         gc  ga                        a q k      h      l            
                   a                                 d                          

        90       100       110       120       130       140       150       160
pacigteedesmeeeplafrg                    rk-s----l-ap------l------f-d-lrgn--rpst
sp  swqsev lrvpvgsrls                    qsr-rspw-w--qrytreasrmsdt-v-s-lvglgyrls
l   kl m d  p n   qml                    eykqheinrtftypagwvipdsltsqwpwwkkeweeekg
a    d l a    l   e                      av m   pvrtirdrrtseeniqrplpgn  tavatviv
                                          g l    aqrel qeqh    kplam g  rvstpkvr
                                          e       p  d eadd    clk      drqlldaa
                                                         a      g       cpik c  

       170       180       190       200       210       220       230       240
vdaat      pmvrstewtqpeqs-wrrnevqgfranscvvgdfhqlhvqqhlqninsvvrqllnlimg lplprqh g
lgtsr      qlqqpsteqpvfgqlqqallplnavslqwlsdayssrrremqallspgphlviy           ge a
pvslf      lglltlsyhlfperhghsangelwsprlsinsttqlplqcl   h g    l k               
gsqww      vafgriqvggyisp sdnwkq irkkkehslmslligga e                            
dl pl      gvecnp pdescmk riethl sqwmgdfcgllae  f                               
 a k       ft ahk  a n kh pfdrgk pptlf d  a                                     
   d        r  fc    e hc hc qca mlida                                          
            f          f  a  p    h                                             
                       a     i    e                                             

       250       260       
pp   pknanga           mk e
 e                     ce c
© 1998-2019