Dataset for protein classical BH3-containing proteins of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------makqpsdvssecdre-rqlqPae------------rppqlrpgaptslqtepq
mskvrvisrrilpetvpyessltmfqi--me--eqeeslsadg-gfg---cmedsdmlalrlseagdqasssgkahrqap
 igfgpg adacmcqllraqlaewvtmpef-vtrcvd-red-rkv-- ed            g---akmddalrhdlf-s
                       plpcqv-g q----ps--m e-es vp            -ctr-m cvkatkg--s-
                           eilc cpslrl-kqh  nad l             aaiavl  q  q -arrd
                             c    phmgg pa  l                      e  k    p l  
                                  l lda k   d                      c  g    n a  
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------d-c--------sa-p----------------sp--------------s--------drspapmsc
gnpegnhggeggllw-s-phgspqgpl-p-asprwygavegpfatr--lfifmrrssllsrs-sgyfsfdtap---l-at
slldcplsrlqlfpltashqqgqrts-shhggtqtlspswtrsgsslysagtelpqgvteepqplrgrvrg--lrv-wpf
lsevamf lgmq iy htcgpelpptgqedkaaaei sqsqtlrpdnnpqyvredermpysvtrffyqslsylpqntl-a
   q g  i la hf r kklvvvsr fmerwr     plesqhhaadagvmqaeceeevqlrespwgnayteimlram-
                q ddirssl  el qfh     a r mdvm  c rll  a aqqlhpaplskgvvr alqeyew
                   a  d                 p g de    ke      fmaag ekl aqpn  hpct v
                                          e               aa  a aee  kl    gaq p
                                                                      a      f l
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
dkstqt-psppcqafnhylsamasr-----a------r------------------------------------------
qrylrerervseg-l-s--kglpr-rqaep-dmrpei-iaqelrrigdefnayylrrvslapsqaggdhpqmvrlrllry
pevgpilrtmrpeq-r-wr----aallpagvstltrlhvssswtnrnrvwwqrlaglhfvnnyssaerngvdpiymtwnr
raea--g-qlld-fwqyraevqi-wkeqrstgsfhqmqrqlhqqsvfqshreitwfqnwsllngeenltqlpk plna g
---- satngkvntvgtfwrwvvvkptekirtqaggglqrtgpvlytlhqsdvnsqcgnkpallv    lilf ck    
fsww qqlmegnlnsdqksqtnltinfvcvlrrwwlwfknpf fgcehaplpprep ml msd                 
eprr pp f dlkimplgkppfgqfidtvtkactlia  f a d aa  lf lq l lh dfa                 
 cih l  e ak h efd ln cneecksag aikf                e  h ee                     
  g  h  a  a        c  l d di d                     d    a                      
  a  a                 i a c                                                    

       250      
....:....|....:.
                
----------------
ivrlvwrmhflsvqpe
s  klkass   ck c
a               
                
                
                
                
                
                
© 1998-2019