Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                       cefcmghaqme tqcvea  aaa ap aqia          
                                        c  laarpad pllpr                        
                                               grc ca  a                        

        90       100       110       120       130       140       150       160
         pmmqqkvaeknaghsvtqv-ss l                                               
         legs--s rressmlpapy a- e                                               
          asdvgk g rilaee t  -l                                                 
           l ddr   d   at l  qe                                                 
           d a p                                                                

       170       180       190       200       210       220       230       240
        ca-tglgtraap va erlqwareigaelrrmaddlndgwqh eivq hsklpgstlqedglksrlasimhs
        a-t-ed d lfy    y  pvpgvtps  digeqppf saga aer  ar  lemsdpdta hll  pgkgr
        -tmkr  a f i         lasfd     d mede e              ciq g h  gke  cfgdf
        pr ea                                                agm d    a     e  e
                                                              ca            a  a

       250       260       270       280       290       300       310       320
yaswve-aw--rvsa--s-v--we-ipwpqgdrrdvaerfgrgfprglltsmrygqmpsqllhwslswsrkhqfklra c
wtlhr-v-vvvfrr-wwqqsvsv-wvgvflthlvvstwlssprvllakgsilhkwckanlgqyvpvqrrafa aeel   
srpepqtpqssenqqvpmlrtpswrryreksgitnllsermlqnag deqhkghs d gfappslpnlp           
rea gmshprndggkqnfiqmlepqesqrikvaglg hcldi       n h      f  nkrkfgag           
m   eanglleadegpk hlkkdnn inqgdss ga g kaf       l a      e  megfae c           
e     a hg  addgh e  g h  eknfcrp      i d                   aaae d             
        ce     ae      a  dile  n                               a a             
                a         cdid  g                                               

 slsa q haiaa    
© 1998-2019