Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------makqpsdvsse-----------------------
mararqegsspepveglardgprpfplgrlvpsavscglmkpgpls-----------ylcsptwvpcvtcalggprwpgg
                                       cefcmghaqme tqcvea  aaa ap aqia          
                                        c  laarpad pllpr                        
                                               grc ca  a                        
                                                 a                              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------cdregrqlqpaerppqlr-pga-------------------------------------------------
prsrprgpr--fpipefslsdqedsssaerglgsadlfaqslldcplsrlqlfplthccgpglrptsqedkatqtlspas
         pmmqqkvaeknaghsvtqv-ss l                                               
         legs--s rressmlpapy a- e                                               
          asdvgk g rilaee t  -l                                                 
           l ddr   d   at l  qe                                                 
           d a p                                                                
           c                                                                    
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------Ptslqtepqg---g--------------q---------g------------------------------drsp
psqgvml-spagdg-s-npe-nhggegdscphgsp-gplappasp-pfatrsplfifmrrssllsrsssgyfsfdt----
       aggva--q-qsgkhhrqapellwdashqveqptssshhaqyervrqesrrtsyqptwesfermsenpsasllq
        ca-tglgtraap va erlqwareigaelrrmaddlndgwqh eivq hsklpgstlqedglksrlasimhs
        a-t-ed d lfy    y  pvpgvtps  digeqppf saga aer  ar  lemsdpdta hll  pgkgr
        -tmkr  a f i         lasfd     d mede e              ciq g h  gke  cfgdf
        pr ea                                                agm d    a     e  e
                                                              ca            a  a
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
apmscdkstqtpsppcqafnhylsamasmrqaep---rp-----------------------------------------
---a-pqqrhrql-wrvlrplimtll-l--e--aadm--eiwiaqelrrigdefnayyarrvflnryqvledlprmvilr
ldv-lrrl-aa--yvlg-y-cf-gf-v-wt-ev-peslsntaptttqmnytsswtrsrvpqswkdnrsatlwhllsslhl
yaswve-aw--rvsa--s-v--we-ipwpqgdrrdvaerfgrgfprglltsmrygqmpsqllhwslswsrkhqfklra c
wtlhr-v-vvvfrr-wwqqsvsv-wvgvflthlvvstwlssprvllakgsilhkwckanlgqyvpvqrrafa aeel   
srpepqtpqssenqqvpmlrtpswrryreksgitnllsermlqnag deqhkghs d gfappslpnlp           
rea gmshprndggkqnfiqmlepqesqrikvaglg hcldi       n h      f  nkrkfgag           
m   eanglleadegpk hlkkdnn inqgdss ga g kaf       l a      e  megfae c           
e     a hg  addgh e  g h  eknfcrp      i d                   aaae d             
        ce     ae      a  dile  n                               a a             
                a         cdid  g                                               
                           aaa                                                  

       330       
....:....|....:..
                 
-----------------
lprysgrlvwrmhssvg
nlplivgqtpmpkrcg 
 wstepshslllf    
 slsa q haiaa    
 g               
                 
                 
                 
                 
                 
                 
© 1998-2018