Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------makqpsdvsse-----------------------
mararqegsspepveglardgprpfplgrlvpsavscglmkpgmgs-----------ylcsptwvpcvtcalggprwpgg
                                       cef laaaqme tqcvra  aaa ap aqia          
                                               pac llrped                       
                                               cpa chlga                        
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------cdregrqlqpaerppqlr-pga----------------------Ptslqtepqg-p-g-----g------s
prsrprppv--fpipefslsdqedsssaerglgsadlfaqslldcplsrlqlf-stagdg-s-n-e-nhgge-dscphg-
     pgarpmmqqkvaeknaghsvtqvaas l                    llpha--q-qsgkhhrqaptqlwdash
          alsdds rressmlpapy sr e                     ga-cgdltlratsvedkaelwlspig
           g vgk g rilaee t  ql                       --t-c  g a p q  e   taread
           s a r   d   at l   e                       pgmer  h f i        v gvt 
           c   p                                      k      a                  
                                                      a                         
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pq-----p---g------------------------------drspapmscdkstqtpsppcqafnhylsamasmrqaep
--gplap-asp-pfatrsplfifmrrssllsrsssgyfsfdt---------rrqrrrrl--r-lr-l---ll-------a
qseqpmssshhteyprvrqysratsylpvwesfprvsenpsapplqldvarpql-haq-yw-v--q-imtf-vlwqedv-
aeqrvtlddlvaqeeq lfegprsykpgtvadeeamlsrlessmqswwswleeawa--vsqvgsypvswg-vpwptghrv
s lgrdamcgndgaga eiranhgp  estlppdllkplgaqilgrstqhpa--v-sfrqaqnmlvtpvewigvfltglt
   d    edf s          e   cms gdtg hli  pgkegrrleg-vvqsgeplvpkfhsmlspqeyrrkseir
                           agq      gke  cfgdeqfe  mtppledkgkli erkkrnh sqqikvan
                            cp      a     aa amea   sgli  geggh d fhdl  qnlfdssg
                             m                ea    n hg  addae   cg a  ikiecnq 
                                              c     a ee      a         dihd  g 
                                                                        cdea    
                                                                         aa     

       250       260       270       280       290       300   
....:....|....:....|....:....|....:....|....:....|....:....|...
                                                               
---rp----------------------------------------------------------
adm--eiwiaqelrrigdefnayyarrvflnryqvledlprmvilrlprysgrlvwrmhssvg
peswsntlptttqmlntsswtrsagpqswkdnrsatlwhllsslhlnlplivgqtpmpkrcg 
dvwlrigagfprglnysmrygqmrvqllhwslswsrkhqfklra c wstepshslllf    
vsteqfsrrvlnakgtilhnwnkpslgqyvpvqrrafa aeel    slsa q haiaa    
rllslsmpqnhl deshkgkscg nfappslpnlp            g               
laahelliflag a q h hr d f  nkrkfgag                            
g   ckdf       l e      e  megfae c                            
      ad         a         aaae d                              
                              a a                              
                                                               
                                                               
© 1998-2019