Dataset for protein classical BH3-containing proteins of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------makqpsdvsse-----------------------
mararqegsspepveglardgprpfplgrlvpsavscglmkpgpls-----------ylcsptwvpcvtcalggprwpgg
                                       cefcmghaqme tqcvea  aaa ap aqia          
                                        c  laarpad pllpr                        
                                               grc ca  a                        
                                                 a                              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------cdregrqlqpaerppqlr-pga-------------------------------------------------
prsrprgpr----mfvirlfsqsevedssssllsadlfaqslldcplsrlqlfplthccgpglrptsqedkatqtlspas
         pempqpsfpendphsptqv-a-                                                 
         lags-kkaskeagelespal-y                                                 
           ldd-rvg r sdilatt lg                                                 
           d ase   l  aa me   e                                                 
           c  g                                                                 
              d                                                                 
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------ptslqtepqg---g--g--------------------------r--------------------------rsp
psqgvmlergvgps-a-npe-nh-gegdscphgspqgplappaspgpfat-splfifmrrssllsrsssgyfsfdtd---
       -ga-aggttqdgpsgs khhrqargllwdlshqqeqptssshhgrqtsysrslecrqlsnpralklqssslls
       ac-tte-q-raay vr ereqwpaeigavarrmeddlnaqyerdgreqvapkwremhhqftl kr lldeshq
        ar --pgmelfi  a y lpl  sfvlgvtisaqp epmwqf egva   epq iggeyhd gm    a  f
        -l krl d f               p    dg    d  ed  aeg     i  eed daa a         
        q  ead                                      a          d                
                                                               a                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
apmscdkstqtpsppcqafnhylsamasm----------rqaepa-mrp-------------------------------
-----eqqrgrra-wlvsrpl--------flslwrsgva------d---eiwiaqelrrigdefnayyarrvhlnnyqar
ytvgvprgqsmq-rvrpqyacimgllvleacggt     tgevapglwtngrygrsydnytrskpqsfgkllfkplrwwt
wllat--d-h--vqapgll--hwenvpwp          veprvleslsiylqtlli lvshhhvdprttkgerlvsssl
vepwsrt-v-vsre-a-f-vtfswwrsvw          sahasvaagrtqiwntk  dmla  tcmaeqaravipqrpa
rcihrqmhlvnlndr-w-qsrlptrikrr          qtdtrtstelslgrfeg   l    s g  l qssfmdfc 
la elalahrlgg lwntiqq epqeiqn          lrvsgrnrsfrkf   d        m d  a nppefa   
    e d eekfe ksd elp an  gnl          ipsp nl aelde              a    mlnd     
    d a c ead   a  gk  h  eki          gdrn g   chad                   kk       
    a   a           d     cif          e ml d   af                              
                           aa          d  i      a                              
                                       a  h                                     

       330       340       350       
....:....|....:....|....:....|....:..
                                     
-------------------------------------
splpgsvtlrlqryivrlvwrmhwlrnlsrgsslpsq
pdharmwismrlssvwtrllqswldpl gg lhallk
ewtsktsvqipwvlsgl  flal              
kksfeqrspcnf cla                     
fhqe gllh ea  g                      
  n  eh a a                          
      a                              
                                     
                                     
                                     
                                     
© 1998-2019