Dataset for protein Puma of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        : *:.:* *.*  :* *  .:.*  *.  .          
---------------------------------------mkpGmgsAqAcPtqvPrA--cspTwvPcvtc----------
mararqegsspepveglardgprpfplgrlvpsavscglcef laa p a cll a ylaaa ap aqiaalggprwpgg

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           *********************************************************************
-----------GPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
prsrprgprpd                                                                     

       170       180       190   
....:....|....:....|....:....|...
*********************************
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
                                 
© 1998-2018