Dataset for protein Bad of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                                        hs  pags

        90       100       110       120       130       140       150       160
. ::   .:*..      ::     .::        :            .   :. ..        : *     .:    
spddrmhse dpfmgqldaslmsavgserggqhaepmpltavgswrs-lar-kspgvargmgsslgyt kysfapwgdan
 d  ggg     ak aea  g n p  dleage  nlkd  ldlfkk a h e      al qhke     f  afaa g

ag g la ghsaiaarcg 
© 1998-2018