Dataset for protein Noxa of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******************   .  * :   **  :::*    :***.                                
MPGKKARKNAQPSPARAPAg-pvgtAtqqrrFGikmqlR----qKLLs--------------------------------
                   eleaec rdlag  dglnf ftrgk   nsssssplalprgheeqaqvagsrvcystqeiw

        90       100       110       120       130    
....:....|....:....|....:....|....:....|....:....|....
                 *: :* .* *                           
-----------------LlsnLtcSkT---------------------------
rqtelpaetsesdiqtl irk fa g cmrgllqksflrrctfhqfeerlhcnw
© 1998-2018