Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
makqpsdvssecdregrqlqpaerppqlrpgaptslqtepq------------------p---l---------atrsplf
-mfeipefepseqedsssaerglgespagd-psg-sklhr-gnpegnhggegdscphgs-qgp-appaspgpf-------
 -----qcvrkledq--vfasedwvgvtq-qsllqadhfarslldkkllsssses vpaagllwdashqqeqptssghhg
  mmvr-saednaqpvprysqvtpaatqeve---g-----dftrg      hl   lal r vegvtqveasrcplerqq
  sfgmpmpqakpmktllr  lre  emic cqp isrql                    p h eqgpta dlvvy tfe
     gkl g ilc naap   ga  c     gf  rmag                      a  gae   a gcm eed
      gk                        a   g  e                                 d   d  
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
if--------rss----s-d-drspapmscdkstqtpsppcqafnhylsamasmrqaepad-------------------
--mrrsslls---sgyf-f-t----s-a---rg-----g-tleprrlfygllrpl------mrpeiwiaqelrrigdefn
lwplteccgpglrytsqtekeeqtl-n-tpsqlvmrsc-vrv-aqq--l--ve-vsdvavsspriypqteqpsgvprpht
glrqvhlrsrttmpdptedsatnrgeeplam--rllkalm-ew-a-sygrr--y-ecsvlglllvll gtgrpqyqhsws
sagcmiipqlhreasiswsqyrgmtqskd lmqasqgdfwv-vy-lrr-qqpvwnwvtgtlpwfngf f dkklplwqkr
q eae gaae    pglnlpl  ls d   g  qhia elsrstseqmqnpinrmpprfpeffcfad    idelcfhem
e a            dg ald  gr     f  led    naplfdpgelnglnklmlsg  ea        adga    
               a        h     e   ca    k ng akeaek ikikli d  a           a     
                              a         d l   i   h hieghh                      
                                          c       e gfdfe                       
                                                     e d                        
                                                     d a                        
                                                     c                          

       170       180       190       200       210      
....:....|....:....|....:....|....:....|....:....|....:.
                                                        
a-------------------------------------------------------
-yyarrrrlnnswtrkdhprswilrllryivrlvwrmhlrpplsggltqrpkssvr
rpvptllpktlyqgaeyvlqmvwsqrsvnrawwqllll lsltlpsqsnmngrgpg
qgteqgvhtsvryaqswsfkvyvkaqqqll l li af hnssenqhhlllfacg 
peqtiamfsqsqswlfprahpsqh nng            g aa  eeaiaa    
ddfq qnerppifp  hn aaqgd ga                             
  a   kkqlmgad   l   faa e                              
       gnike     f                                      
       a hfd                                            
         ec                                             
         d                                              
                                                        
                                                        
© 1998-2019