Dataset for protein classical BH3-containing proteins of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------makqpsdvssecdregrqlqpaerppqlrpgaptslqtepq---
mfqirplsrdilmetllyeqllepptmevlgvtese--fe-meqedsssaprg-----lgespagdqpslgsklhrrgnp
 sev                                pe--g-qcve-ledd--vfasedwvgvtqcpslgeadhfalapl
                                    emmm g--a-k--cqvpsarlvtqlacqiaemqv vsmat slr
                                     dlf  ks-ranpqmskrr kngpa ti    gp ircql ft 
                                       d  gkfq  am e kd   a         ef  gape  q 
                                           d         a              d   e       
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------p-----g----p-s----atrsplfifmrrssllsrs--------------------------------
egnhggegdsc-hgspq-plap-a-pgpf-------------------ssgyfsfpvlvgselsqgmsrppsvtrarhpe
dkvlmsssslgllwdashqqeqvtvsshhgpltsyelwrlthcsppglrptsqel       dge kleelppsfgq a 
sdkalh llesfvylqtehirggqtqfsrcgygrvqqspqhercgnptmqddatd       ada  ga aadfe p   
g      hg a ip  r de dapraampvvt tssprwgswnaqatrlgmllna                         
             a  p a    l   ad fg lqpnisefilyelakeali                            
                              ea ek eea e gpde  a                               
                              c  ae       d a                                   
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------drspapmscdkstqtpsppcqafnhylsamasmrqaepadmrp--------------------
nvklealglwrsgvadt-------------r---------qrlfglrglplp-l-g----eiwiaqelrrigdefnayya
               tatqptslatpsqgg-sycgvteeppa---klvnf--p-a-sstqmlfsstgppvyqwwwrreve
               kypvtrqswatqryvmlwvswrvvyl-syy-kl--nskvvvllsllaqrgvwtdqpcsqhsqnqq
               srstrlnrr hmgwrlrlrrrsrlt-qrmlg--vykedsspgppairp fsq alg hh d dlg
               qprnl gek aleqlhqk fmedclvlq eeprrwiwltlntilrvpl cg   ef f     a 
               llea    g  k    k   l    fdp adnpivelhrgdqhhkngk  e              
                          e    e          i   a hrdgeie efecffc                 
                                          a     gl dc    a    a                 
                                                ei                              
                                                ae                              
                                                 c                              

       250       260       270       280       290  
....:....|....:....|....:....|....:....|....:....|..
                                                    
----------------------------------------------------
rrvplpnyqaaedhprmvilrllryivrlvwrmhlhnlalngeenrngagpr
qgrhknvswtqkwrlkvsqhqqnqnr wwqillf                  
illfrqsqsplfhlahsq                                  
 assalpiad                                          
  nk eld                                            
  me df                                             
   a  c                                             
                                                    
                                                    
                                                    
                                                    
© 1998-2019