Dataset for protein Bad of organism Pan paniscus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************************************************************                  
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSSKHHRQAPGLLWDASHQQEQPTSSSHHGg-----------sy-ptw
                                                              eagaveirsrrt--sgst
                                                                        hs  pags

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. ::   .:...      ::     .::        :            .   :. ..        : *     .:    
esee--senpsagrlrsrsappvlwaaqsyqrklrrvsvef------gvp-p-taptptqrrttsswgR--vpqsywkrr
spddrmhseadpfmgqldaslmsavgserggqhaepmpltavgswrs-lar-kspgvargmgsslgyt kysfapwgdan
 d  ggg     ak aea  g n p  dleage  nlkd  ldlfkk a h e      al qhke     f  afaa g

       170         
....:....|....:....
    .              
svrsptsgsq---------
lrlpssepqltqmpfssvg
ag g la ghsaiaarcg 
© 1998-2018