Dataset for protein classical BH3-containing proteins of organism Otolemur garnettii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
      fepqpspss-vs--vldrlrdepgapqpdnnmpsdpfc faepg daq-stlstmhtlpmthlqpqet-tgtlq
        kameddq pppphg qgm  gc fpm klleaal           pclr qsfelghlsg nlp elqeskc
          e   m ee  ge pf   e  c a hf                a ge l   aegcge gan c ndhha
                     d la                              a  a    ada a e m    a d 

        90       100       110       120       130       140       150       160
agpgpvgwrqrhsmr rsv                                 vdlrqsplse-qsyrtrv rsppfnhml
    gqet gqgrap c t                                  aeqlrcipdnmhtqs l plfg     
    a a     l l                                        p   fgc kdihe   acaa     
                                                            ea e                

       170       180       190       200       210       220       230       240
                            *. : . :                                            
saslsgpyratqlt-wwqerwevqiga- qsiasqlhrytetrvprwrrrsrsrwvpprssptqywrwwvn--wrrp---
mhmfrmstqsqegqrvrpqqyare --r kcvs g tqsrprilgmpnylgtqprmnhqralltliqsilmrnvpanrsl
  l    qne denlqeehma     qq  ali d enrhkngaflhkvaa ghedhapm ie   pn ilglql hleh
       ig    edlaa         k         dqf k   f      ee ac ng      ll hdaa g g ae
             a g                                     a    a       ff ca   a     

pcpeke l
nan a   
© 1998-2019