Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------makqpsdvssecdregrqlqpaerppqlr----pga---------------------------------ptsl
mkpgpls---e--q----s-vt--vywqrqgygttavpgvr--llsadlfaqslldcplsrlqlfplthccgpglreeew
 cfcmghrgs-vrpivrr-ssswvrrrnlsssarqtal  -rs                                 skqq
       arrg p-frgdlrmpsppfglelpg gpq    tdr                                 lddf
        mmc cacpeailkdplnceicdee aml    aap                                  aa 
         e         edaagl  a a a  ee      m                                     
         a         ac   a                 e                                     
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qtepqg-p-----g-g---p---------------------------------------------drspapmscdks---
edslt-n-egnhg-e-dsc-hgspqgplappaspgpfatrsplfifmrrssllsrsssgyfsfdt------------pii
vvmikttlrpmspstnaqyerrvteeqqrlvylraerlsqvvevamhslglafiydqtedirdvlrsmrrtfwtrrrne 
grkfhqq srkmedsdvml clrqi demdfsa   pka ls                       a fqqgetrfme   
dp egfl lqcad qatla   ac                                            mda pa  a   
a  cdad   a a l                                                                 
   aa                                                                           
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--tqtpsppcqafnhylsamlsrl--------------------------------------------------------
wlrrrrrswtrvyrwwwlrlalmrqasptdmwpfgwiaqelrrigdefnayyarrvhknnyqaaedhprmvilrllryiv
riasssnrasvnsqtrmplvvgkalsvllvsrweirynlssdly hhhsqdteqfnfldfs                   
  wlqllgirpllpsqygwrwaapgvegaqqlsnelrltn               le                       
  qhp f gqle eqkreqnpvwielaavplell flfkg                                        
  mde a dpgc  li dneirvgshrvsia  g                                              
         kd   e  a  gnpefelspe                                                  
         g    a     diid d  ea                                                  
                    cef  c  d                                                   
                      e                                                         

       
....:..
       
-------
rlvwrmh
       
       
       
       
       
       
       
       
© 1998-2019