Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------makqPsdvss----------ecdregrqlqpaerppqlrpgaptslqtepq----------------------
mkfgmgs---evrqrrrrssvtwvplw--a--stvys-----aemqvervl-a-lfrrgnpegnhggegdscphgspqgp
       arsc lpivggprsappncqvi-myplrprqrvsg-ttewaslkq-r-rlmedldpmedfsplq mlsrlalf
        mpk grfpea pa      iaqlsnglfgllsgeeretdlgeigfkrlgh         dl d  e  d  a
        gm  chcg           d lggddeae gpea g sa fada ggdae                      
        ce    a            a ec aa  a ela       c    dd  d                      
         a                             d                                        
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------drspapmscd-------------kstqtpsppcqafnhylsa
lappaspgpfatrsplfifmrrssllsrsssgyfsfdt----------pmnpqytrrrqiirqrrrsplwtrvsrlwwrl
prthcigpgmrvtlreprltqtlevamp qgvmlpygvteeqrtvwraflegktefkenee-lmsqrnsasvryqeqmpw
 lla c deldps qadkaa l  p  h l la ic qa diqsllysdadafs       tvwhsqk lrmppptirlr
                                          kragtr             qavfdae gplllksfigq
                                           d fa                na  a  ngicfi cdg
                                                                      d   e   ae
                                                                      a         
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
                                                                    
m---r---------------------------------------------------------------
lasm-qavpldmrpegwiaqelrrigdefnayyarrlfkwlasstedhprmvilrllryivrlvwrmh
vvlwleveaaqslwnirynlndely sslsvqwpqfvhlnnyqas                       
tlwvissavvplwsl lrltg daa hhheqdte  neelfsk a                       
qpvrgplrlsiaelg f f                  a d                            
ngrpelhlgpe   f                                                     
eenidge  da                                                         
 ciga d                                                             
  gf                                                                
  ae                                                                
   a                                                                
© 1998-2018