Dataset for protein Bim of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQgnpegnhggegdscphgspqgplappaspgpfatrsplf
                                         ---------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                * . ..*.    : :::                               
ifmrrssllsrsssgyfsfdtdrspapmscdkStqtpsPpcqafnhylsama-------------------l---g----
---------------------a---------- mrqae admrpeiwiaqe-smrqavpadmrpeiwiaqe-rri-defn
                                                   vvwleeevvislwfgf ftgdely ssls
                                                   grii d gd            daa hhhe
                                                    nfe                         
                                                    ied                         

       170       180       190        
....:....|....:....|....:....|....:...
                                      
--------------------------------------
ayyarrlfkwlasstedhprmvilrllryivrlvwrmh
vqwpqfvhlnnyqas                       
qdte  neelfsk a                       
       a d                            
                                      
© 1998-2018