Dataset for protein Bim of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQgnpegnhggegdscphgspqgplappaspgpfatrsplf
                                         ---------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          . ..*       :*      : ** * :                          
ifmrrssllsrsssgyfsfdtdrspapmscDks-----tQtpsppcqaFNhYlsamasmr-a------------------
---------------------asmrqaepa mrpeiwia elrrigde  a yarrvvwlq-vpadmrpfiwiaqelrri
                                                        lrkiessvvvswwegflftssdly
                                                        gnieleestiql  e   kg    
                                                        difdgd le               
                                                         eea   gd               
                                                         aa                     

       170       180       190       200   
....:....|....:....|....:....|....:....|...
                                           
-------------------------------------------
gdefnayyarrvhknnyqaaedhprmvilrllryivrlvwrmh
 hhhsqdteqfnfldfs                          
           le                              
                                           
                                           
                                           
© 1998-2019