Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mpgagvfwkqyravcrgllprqlapaavaaaaratashrsplefapffpiecghqaprvfftldpgaepwhhnseaetls
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------makqpsdvssecdrglgplqpaerp-
wsspgemgtpqqvsllpdhvlglrksepgtrplgslsggrrwrpfaqsmlqipe-rp----dakatppegvqsptedqet
 mh    epakcpeeaeadafqsedgd riqsg ldaadlvscsacepqfdmslf-lslqp-thtvghdqr-qlqvasgg
       ar r egss ep e  ards  pf   r mpsa    l   g pcapae-mereli-c-a----ris---kal
                                                   a  s  aaf m-y-k- trp -- tv--c
                                                           l apgr   rna vv  rl  
                                                              mcp   ha  gn   c  
                                                                l       a    a  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pqlrpgaptslqtepq----------------------------------------------------------------
qy-a--l-----mqqggnpdgegdrcphgspqgplappaspgpfatrsplfifvrrssllsrsraatnshhggrgpaptr
-tm-ep-rgvni---v                                               gvteepqrldasamems
gswsgavlsqgvhlcc                                               ssryprpdtfypnlgya
 -ak  s dadlqvt-                                                pggf f  pq s sp 
 r p    w aa hrs                                                                
 p             m                                                                
 d             a                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                      .*                        
-------p-------------------s---p--l------r-e-riareLrrigDefnetytrrr------------aq
csrhtsy-agteqdenmyeslsasigq-qee-pn-rveeeewp-iqygqr-qcms qmhrslrspvitvvlaqdygeaie
ldkssqt spsceafgheleampfrrrprsaaedv      -aaq-v-lq a--a klelcfkg--    fvnlpristh
 plpaef v pplg qpp gqflqlenltqvrqgi      egrne- ak -kl  dwdglh-qqp    rpksa t q-
 qq l s    ape        dph gfn h ae       ht v f --  a   avyn--s-lh    qe m  k ep
                       le   l            f  r              crwma d    a       -k
                        a                                  aqae               r 
                                                                              h 
                                                                                

       330       340       350       360       370       380       390
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      
rrpqmvwlqllrfifr-l-r-l------------------------------------------------
dhavtysrtgvq--w-l-w-rhrnlgeniwsprvltpgawvspdqdpgqlfpmvllvflllggawylqlq
mlqsasiwrvi-gw-lsvias-trerkggstwsqrsa       nlrqk lnliskl n vt        
---rpgpt-i-yslnpwnlpqdqvpnvpvvllwr                                    
sty--a--v-mparlmqec lpnqiarkpmg n                                     
qnrls-lqprffnq kg n an da lee e g                                     
ndmdrw p f  ld  d    e    daa                                         
l h lp f c      a    a    a                                           
h d      a                                                            
© 1998-2018