Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mpgagvfwkqyravcrgllprqlapaavaaaaratashrsplefapffpiecghqaprvfftldpgaepwhhnseaetls
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------makqpsdvssecdrglgplqpa----
wsspgemgtpqqvsllpdhvlglrksepgtrplgslsggrrwrpfaqsmlqipe-rp----dakatppegvqsptevcgc
 mh    epakcpeeaeadafqsedgd riqsg ldaadlvscsacepqfdmslf-lslqp-thtvghdqr-qlqv    
       ar r egss ep e  ards  pf   r mpsa    l   g pcapae-mereli-c-a----ris--    
                                                   a  s  aaf m-y-k- trp -- t    
                                                           l apgr   rna vv      
                                                              mcp   ha  gn      
                                                                l       a       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-erppqlrpgaptslqtepq------------------------------------------------------------
dqptqy-a-a------mqqggnpdgegdrcphgspqgplappaspgpfatrsplfifvrrssllsrsraatnshhggrgp
aseg-tm-e-llgvni---v                                               gvteepqrldasa
rka- swswpvrsqgvhlcc                                               ssryprpdtfypn
g--r - kg sad dllrr-                                                pggf f  pq s
 lgl r p    q ta hls                                                            
 d   p             m                                                            
 a   g                                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                          .*                    
-----------p-------------------s---p--l------r-e-riarelrrigDefnetytrr-----------
aptrcsrhtsy-agteqdenmyeslsasigq-qee-pn-rveeeewp-iqygqr-acms qmhrslrspvitvvlvqlpg
memsldkssqt spsceafgheleampfrrrprsaaedv      -aaq-v-l- ---a klelcfkg-r     a m  
lgya plpaef v pplg qpp gqflqlenltqvrqgi      egrne- -q qkl  dwdglh-qqp          
 sp  qq l s    ape        dph gfn h ae       ht v f ak  a   avyn--s-ld          
                           le   l            f  r              crwma            
                            a                                  aqae             
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------aqdhpqmvllqllr-lfl-----------------
iaihrlavtysrtgvrgifrslirsltnlreniwswrfandyrevse-rdsgqwfrvv-fiw-lllgawrlqlqggvlpw
ksqksrmrsp p r padlkdecaq rrigdkv    vltpgawa-pqqrpraiwpmiqlv-rqngalnyqlgreestvs
                                     rpksagt t-mnqrpspt-ifls- pwvtp dqnenkpawgln
                                     qe    a h r--dag--n--ynw ng c  p vpala me g
                                             e lty---   cmskr m     a da a      
                                             r hdllqk   a  a                    
                                                 h l                            

    
....
    
----
rrha
q s 
    
    
    
    
    
© 1998-2019