Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mpgagvfwkqyravcrgllprqlapaavaaaaratashrsplefapffpiecghqapmgtpkqpslapahalglrksdpg
                                                         rvrftlepssepwvhnseretls
                                                          afar dgg  ephe  aads r
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------eps-q---------------------------asacdrglgpslpe-----dqp
irslgsmepprrwrpleqsmfqipef---e-edgllsadlfaqsqldmslsrlqlrpvs-etppeg-qlqtarsetper-
wspp edaggqcveeaaddvlpsmakq gdvpg              cpea  mafdm-k--a---v--p--aaglg--k
pmh  rlm savscs cepg  aedga atl a                        lthtv-hrqrrv-qvvcdc sma
 f                     apa   l                            pgrkg dna qs t     pkr
                                                          iyc   trp in       alg
                                                          mcp   ha  gv        a 
                                                            l       a           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-pylrpglpgsnitqpq------------------------------------------------a------gdagamet
g-q-a--al--lqheqggnpdgegdrcphgspqgplappaspgpfatrsplfifvrrssllsrsr-atnshh-g------
tq-r-va--tq---r--                                               vvlrlacil-rspapm
e vwswdsmscvvm-nc                                               gsteerqrtfemdlcl
  t dg  aevgeglrs                                               sprypppd pyvncgy
  r p    q tflhle                                               f gqf k   qpy tw
  g        ma                                                      g  f   k s sp
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        :                       
r-sr----pagtpedeg-----spsrgrsrsappnl----------r-greLrrigdefegsftrr--------aeqqrq
-sp-hssy----eg---melel-afitqvqqeledvrveeeewaaq-iaqq-tnmsenvne-ykg-pransyrt-trhpl
sc-kstqtlvqs--ifqhyesvty--rg--eifrse      rpeiqyias -clr ki--t---lvfpkdageqldmq-
aldlpavf sppcqaankrraam-pp--fpg-rke-      h  re c-- q--a qlwswrvltrgvwvspdndpgkr
 aqqilev   lalksi s mr dqeenpl-haa-i            - k  a   dwhrlhmqqasercd ar----y
   d   s   m pg         ll  ltad--g                      a ynraevs q       helnh
              e          a   n v q                          aq             p dt 
                                                                                

       330       340       350   
....:....|....:....|....:....|...
                                 
salwtllfqllw---------------------
mvilqrvrl-wrgawylqdrnlgkgglvprrha
lpgvwkiifsf-wlnlallqqrnavwstwsqs 
fnmis----i-tnqlaprqvdplrpevwgw   
----lqcvnrvgmgc napeaeege pl n   
drsp-a myn fl a   n  a  a mg     
rla p   af q               e     
p   f      p                     
© 1998-2019