Dataset for protein Bik of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            :  *********************************
msearlmardviktvphdqvpqppvasetpsmkepvrdvdlmecvegRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIH
--------------------------------------------mft                                 

        90       100       110       120       130       140       150
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********************************************************************
RLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
                                                                      
© 1998-2019