Dataset for protein classical BH3-containing proteins of organism Monopterus albus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          :..                                                                 . 
---------sddeeddvfepdp--------------------------------------------------------hc
mhlsrtpsrmesstsvtvtegsgdppsvgaagtsaqssrsnggsersfghpgsagggepvspsrcrtkaiapldslsvf-
 aanfpind  saeea  ek                                                         h

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   .    .. : *             ..  .:   :    .    .   :            .
wrtafreikcedrgtqtagstlapnnsmlPcgvaedprplfygnagfrvhfpahfelv----gdqearrqedqnpmehlp
-----------------sqpstvqssqvs rpsttl-kvtqtptsssqlsshsnqstaqdhksrpgthtptassgsrsss
t si hlprrsss yfsnd dss eqplp  h la  elrmaasprn  mne lacm eaag  e  g  d ga fpgra

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
..            *.:*. :.*::     :   .. *                        ::..    *      .  
rqqrvarsvea-ciGrkLrrigDqfhrellqlyhrrqRnqgpl--------wwrlattllsllfdrgfiaGgggagrr--
ksappilwmqkeky qq qlms eynslhdkgemknv vvprisqmhhsksti-------vyvisqqitq sntsqensq
   na  daa  av  e      dnh  e ad  r sa aa     qel  v cvgi     ghiele einhhd aa

       250
....:....|
          
----------
vaqevervvs
l         
© 1998-2019