Dataset for protein Puma of organism Monodelphis domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vrlgeapgkplspgcgsgqrgpggagsggagrgggsrsrrrslsspalaspnclgadgcrragagggsgagrsvtsrgsr

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
garlqreaaaaaaaaepawepaaqdtcvrpagatagagagavasgggdrgggssssssssssssssrgssrgsggeqaar

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
sqappgrpgprltapqarprrrvhapgglgvglrsgecaprlgvrvpcrergplsprcccrcecgaglgklrrgrargva

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     ***********************************************************
---------------------MARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPAL
ppltcsahlsvslrrlpphwg                                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
APSSLLPLAYFCTRQPRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQGASPMSGGPPGVLGPEHGD
                                                                                

       410       420       430       440       450       460     
....:....|....:....|....:....|....:....|....:....|....:....|....:
*****************************************************************
QGEQQDREIGAQLRRMADDLNALYEQRRREEEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN
                                                                 
© 1998-2018