Dataset for protein classical BH3-containing proteins of organism Mola mola

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             ::*::**:      ** .    *:.    :: ** * *   **: *     
---------------------------qteqEqqVFq------PElrmwrtTlrvkkeeerGTqTpG---APysGr----
matnftissdseselseeieegensqlmddd dd  erhtltl  ahcagr fqeigcdda  p d pal  fr mlpcg

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                ... * :  .    **.*. :.*:* *:  :       .* :*.  **
--------------------------------srsqPvslwvekkyGQrLrrmsDqFhRqhwqtys---rtQrnQsrsWW
vaeeprhlfyvtsslapdsrdncrerngmerlpkqa pahsaaaci  k qlig e d eemklrhagtan mh gpl  

       170       180       190 
....:....|....:....|....:....|.
       * **..    * ..          
-------SyLFsrqftdGgnnhhrs------
rlgsall l  dhgefa eggagdrhthrne
© 1998-2019