Dataset for protein classical BH3-containing proteins of organism Mesocricetus auratus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          *                                                     
------mapqpsdvssecvreggqlqPa-----erppql--------------l-arpgaqsslqtpqq-----------
ifpgemepk-qveelppddfqsedge gvcgcgtqslgrlvpsrvsggllssg-s-ptf-ptqfdcelsgnpdgrlqlfp
      ---sc---nedsppgrarss -     pfrgsn    aricdkdepewrrdqata-lapalgl     epstqe
      gtqr-pssmcapnlhvrkdp r     itia            cag rpead-i-vr emayk     cgprc 
      arakverqaa haeal h d       d                   pg   v  lm  i ef      adea 
       l   agl         e a                            c   i  a      d           
                                                      a                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------p---------------------l------------drspapmscgkstqtpsppcq-------amaglrn
lthtcgpglr-isqgdpatrtlspaspsqgvm-spgvsgyishqttqhrqslrydnpgyrltlvasafnhylsfp-sipq
psvcadrlag swpepkrsqsrlfrpvrpsps pcssl nfrfdqeeelsrtfrsaaprveprs--ecv q r--ylvql
hgspqal  p rlt gs   ppg ifdgrqsl aral        qlrkrvsvprsteamalgath       ssptkgg
dan        a                   c             kaaanaphipgr  l gd rd       rigdcea
                                                 e   h     d    e         ad a  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
leqe--------------------wqar----i--elrriadefn---------------h-------w-q----f---l
srepgmeeelspfrgrpadippgqlihqaevq-srk---------esyrrrvnnrqhieq-qqhrqrv-w-vlql-lvr-
gqhr            srsareei -wlisqsyga-tqcmglqrhsqfkglprpyledqdtphnpdmailvlfnrwiqn 
ekdk                  nl pnhgdkrqalv aaws glrga e     ksrqteqhrrqsss trmy s mgl 
  a                      lifcaalkv q    l d ea         rag a  m  pap r ii       
                         a     ef  a                                            
                               a                                                

       250     
....:....|....:
               
---r-----------
vwr-henregvgpwq
aln epgkpest s 
p p nl ag me n 
  d d          
               
               
© 1998-2018