Dataset for protein classical BH3-containing proteins of organism Meleagris gallopavo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 *  .*:. ..*:                   
----------------------------------------------sysCllsRwrshsLth------------------
mdrpsyleedyssldgldddvfhsddfglagqpgemtatgiftqnqfll aag fqlfp aeccgpgvrhpeqqdkatqt

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                      * ..*:.**.:*. *.*:*:      
------------------------------------------------------EirtEvwIArkLrrIgDqFn------
lspssssqdvmlpcgvteeprrlfygnagyrlhvppvgfaldpnlqeepqegqr aqp iq  qe qc a e hasycpr

       170       180       190         
....:....|....:....|....:....|....:....
* .::.*  * : *  .*: :: .*  .::         
RlhlqrHqqNrqvVwwrLllylirLiwrvq---------
 gfidn ag pnq ilq fhfihn alnmeanrnrtgqr
© 1998-2018