Dataset for protein Bmf of organism Mastacembelus armatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************************************         : *   ::. *.:*:    :*:*  *
QEREEEQNRMEQLPRQQPLVHSVEACIGQKLQLIGDQFHREHLQLyhlnqrnqgllWwrlatalLslLfdr-gfIaGggR
                                             --------qvg apetsgs pv lacltl t vw 

        
....:...
 *      
aGrr----
e --ppcp
© 1998-2019