Dataset for protein Bad of organism Mastacembelus armatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAAKFSISESESDSSEEVEGGKQKKSSARQEQQVSQRHALALPELRTTASNRIRLSSESQSRVDEEAGTPTDGAPFRGRS

        90       100       110       120       130       140       150     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
***************************************************************************
KSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRVRNAGKAQKMHHSKTWWSYLFSYQETDGENNLHENHTPRTE
© 1998-2019