Dataset for protein Noxa of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******************                                                             
MPGKKARKNAQPSPTRAQA-------------------------------------------------------------
                   gqagtagtardqagfgigmqlhftrgkklvsssplalprgheeqvqvarsrvcystqeiwr

        90       100       110       120       130   
....:....|....:....|....:....|....:....|....:....|...
  ** .* :                * :* : ..* :*. :*: : : : .. 
--ELpvEts----------------TqlRrlqkrLnlRrklLnliekrlhsnw
qt  ea caesdsqtlllrnltask ci gfgdk ff qci hkfaelfccgt
© 1998-2018