Dataset for protein classical BH3-containing proteins of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------makqpsdvssecdregrqlqpaerppqlrpgapts-------lqtepqgnpegnhgg-----------------
mfqipe----eqed--saemglgpslagdqesdcgkhhrqapgllwdashqqel---------egdscphgspqgplapp
 sgvrpfeps----rc---lpdkvfrkeag--ptqaqssl-ad faqs-ldc--ptssshpiptqwyetrsrlsvyssst
      isrdmepstlve ql dkatmn--  ga------e   vlgvt---tdsrlqlfgd melvfdsdmklssp gs
          tlme  ly    e         --    g         gtpg ardqmedf  lacm    khalr  cl
                                      e          da   l  a     g ah            i
                                                               a                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------s------------------l-r--s--f----drspapmscd-----kstqtpsppcqafnh
aspgpfatrsplfifmrr-slvslgaaqsygqtdenv-s-ss-gy-sfdtatl-----lgpatrsrrsplwtgvteepqr
seerghseqpsarrqlsavappnvwstlrqdrla   klhclgpglrptsqedrvtqtretisqyqgvmalrswvds---
pwdsevelnvqvlmlree lrmlaplefiea      etkrcpvtwvdgf---ktlyvavrtwpwwqlsskcrsss-wwv
gl mdm dedarklgad   mh     dg        di pvlrs l svtsr rctpvrnrpgqtikgneqnirrrqtp
ed e d  aa p a                          dm le a rpkgp qargtqmhmemgefcf lafgkklrn
                                        a  d      e a   k   g l l  a e f ef  ell
                                                        e   e k i    d   aa    d
                                                            c   f              a
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ylsamasrrqaepa------------------------------------------------------------------
lfygrgasl-----dmrpeiriaqelrrigdefnayyarrvklnsyqaaedhpqmvilrllryivrlvwrmhlhnlalng
--l-lv-vktlsvggsplllprtpqqpygewrrrvtwqlnrfksniadqfhrlhvqqhqqn nr wwqillf        
ryarq-ve-pdvstsltrgfllrmlplkfqhhsqdqvpiemsdqpd                                  
pt-nptr-mlslrvlqsqvpkfggidhe heqlhcne  allapc                                   
 nrknlnyierigd plfi i cea  c    he e    he f                                    
 i   hlwgapqa  fka  f  c                c                                       
     fipese     h   a                                                           
      gld c                                                                     
      eia                                                                       
      cf                                                                        

       250
....:....|
          
----------
eqnrngpgpr
 ee g a   
          
          
          
          
          
          
          
          
© 1998-2019