Dataset for protein classical BH3-containing proteins of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------makqpsdvssecdregrqlqpaerppqlrpgaptslq--------tepq--p-------g---------
mepsrcvemfqipefepseqedssspesgagkslagdrpsdcgkhhr-apgllwdash--gn-egnhgge-dscphgspq
        ele-------------qa ks sanaqasstlaqplsr-t    vfpl--qeeqqtssshhgqlhwyetrsr
         sgddviqredgmpgamy qk r dtfeqp--------ve     lgvagtardldpmgifmptgfvrdkkm
           vrp s  tl  tll   l e l m --     gqeg          d     a fed d geat   dl
                                           ela                         aa m     
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------aspgpfatrspl--fmrrssllsrsssgyfsfd-drspapmscdkstqtpsppcqafnhylsamasrrqaepad
gplapp------------fi-------------------t-----klr-----f-----tlp------------------
vssylaccgpglrpseqpskatqtlgsarpnqgvmlrygvteervr-ftlgvw-adgfy---vpasrptvlrwgrspspt
la s lstseesgvtvredarrlltaprpvllwlaqpqkqlnlnq-y-rvstsyvtavtrsttvtdsvrtvgiwedvawg
h  r  gpewdremqlnvprllgaerv mmgvpatdicarad i eikpsprewrnrlkkprslsvprnltvfnptsvvf
       l r mdhededapkac dq   h dksn ge l a   d  dqll rq egege rergfqlimqyllqqnts
       i d h e  aa       e   f a  e          c  amei  l  eaaa l k agghkpmi kigkr
           e d                                     d  g       a    e agnee ecfeq
                                                                       l d  a d 
                                                                       i      c 

       170       180       190       200       210       220  
....:....|....:....|....:....|....:....|....:....|....:....|..
                                                              
mrpe------l-r-------------------------------------------------
----iriaqe-r-isvlalgdefnayyarrvflnsyqaaedhpqmvilrllryivrlvwrmh
swrgrawvllsgygqlmpssshglhqwqlqlsrsnvwwtillflhnlalngeqnrngpgpr 
rsfrswrtrtdlqllsikfqvgrqvvqpkncnkprdssq             ee g a    
qvvslqqrpna lhich dlhrshttllheqmelpa                          
glqqfplpgi  kc  a ahf ledni f mldfl                           
eilkaikd f   a     ee   cle   hka                             
cach ef                        e                              
a a   e                        a                              
                                                              
© 1998-2019