Dataset for protein classical BH3-containing proteins of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 epspc--------                                      -h---mp kktsqeak-tp --------
 sgv pvseltdme                                       lcygql e arkn-- -- t aasgsq
      i rd l                                          l        tm          q    

        90       100       110       120       130       140       150       160
gvmvpcgvhe--drtssshaiptswvetssrlvlyssstpeerghseqpsvrrqrsavappnvwstlrqdrla   klkr
    lgv---gtaplfyepgeyrqryvdrfpksvspggsswdsqwelnaqaqmllklqlrmlaplefiea      ei p
       tdp   ldqmaffd mlpmpa dmhlsri eqgp mevqheverllgaee cmh     dg        d  d
       g a      a d   lellf   kaa    clel edm dadapkaa d   i                   a
                      kach            i d   d                                   
                      g a                                                       

       170       180       190       200       210       220       230       240
vlrs rdsvts-qteyvvvqtpgytqlgsqqnss-vqtqrtar-vavapdivtslsrgpllrgi hkfeerrhdqep el
mgle l rpkgrdrctgtrprmeqhikcnllgrrsrprppnrnqhvlmlsvrvnrnqilkfcc        lecn    h
  d  a   e p qarelgnhl mgef hkgainkklqnii k trekenqgelqlgagi                   c
             p k   mfk i  e fef fg eell   f llwiaeled  kf  f                    
               e   gch f  a d   ef    d     fiig cga   h   a                    
                   e f          aa    a      cfe                                
                   c                           d                                

       250       260       270 
© 1998-2019