Dataset for protein Bim of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQgnpegnhggegdscphgspqgplappaspgpfatrsplf
                                         ---------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          . ..*     . :*      : ** * :                          
ifmrrssllsrsssgyfsfdtDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMasrrqaepa-----i---------
---------------------asrrqaepa mrpeiria elrrigde  a yarrv-el-----dmrpe-riaqelrri
                                                        -v--edvvtssslgfiltgldlyg
                                                        lrwilessvg lf  af       
                                                        gnie  igd               
                                                         ifd   a                
                                                         a                      

       170       180       190       200   
....:....|....:....|....:....|....:....|...
                                           
-------------------------------------------
gdefnayyarrvflnsyqaaedhpqmvilrllryivrlvwrmh
hhhsqvtwqlnmsksnd                          
   redqep elldpp                           
           hkaf                            
           ce                              
                                           
© 1998-2019