Dataset for protein classical BH3-containing proteins of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       .                                        
-----------makqpsdvsse------cdregrqlqpaerppqlrpga-------------------------------
ikfgvgsarac--me-ercve-wvppqv----------edsesgeqglsslsadlfaqslldcplsrlqlfplthccgpg
           pfqir-fep-trg caiqelsddvfml-kgsraaaqpg                               
            s-- r---rg      lmpqpsr lagskalknvlsr                               
            cgv ppsrd        gc agl g rqtleyptaae                               
              c cilha        a          h as                                    
                 a                                                              
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--Ptslqtepqgnpegnhggegdscphgspqeplappaspgpfatrsplfifmrrss----------------spapmsc
lrlspaedkatqt-g-ar------l-----eg--------agy---l----------llsrsssgyfsfdtdr-------
   lrqgarls--l-p--psqsvm-dcsvt--qqrlfyhn---rlp-qasfpavspiyaaklacigdemeaslrvsvlae
   kama-g--dsgkhhsqapellwrathqlltptsssghsqtvwyvaveergdldlvslgt     ql vgmpsprsvt
   gt  g- hvraptvlrrr rwanvrga prywawllf erksgrvswytehknnpp  m     le e aemlappq
        d e etmwr dqf qv gfpqk  nrm mefc aqgramsphtssghkmd          a     ee g l
          a aca q  ea  r  eid   d i kdda  pei g  dplr  ea                 a    f
                       k          d d c   a a d   lil                           
                                      a           c                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
dkstqtpsppcqafnhylsam--r--a-pad--p-------l---g-----------r--l-------------------
--------------------las-rq-e---mr-eiriaqe-rri-dewwfnayyar-lf-nnyqarndhpqmvilvlll
lsqvrgeqqwegqwqrraev-iawkrqliveqfhrlhvqphqqnrnrvkgqirsflpnvavrgeenaegarpssl     
rgeshsavlvlwsyylqmvkqvwpqltcvrtfvdsfttlltptvlvtsttwrllpfhtswkyswwpsqsgggrnm     
prrrerqp nrvlrvdistqipviitrvspswsenvsqt r ksatntsrywqksswqrvfsrptlptlterlhh     
eqghamhe garfirc nrlegrfekkrll tm gpkgp l eg rgimqmggglqtgmscqphrhhgfpqhq c     
   g h a   fea   gge  nedghmgd  e ade   a  d eahllcf finkfglapadhe   e e  a     
   a e     a      dd  l  ee a   a   a          a      c   ae k c d              
                      i   d                                d                    

       250       260 
....:....|....:....|.
                     
---------------------
llallllrllryivrlvwrmh
      plssggltqipk cm
      awqv   hl lf   
      nsf            
      kd             
       a             
                     
                     
© 1998-2019