Dataset for protein classical BH3-containing proteins of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       .                                        
-----------makqpsdvsse------cdregrqlqpaerppqlrpga-------------------------------
ikfgvgsarac--me-ercve-wvppqv----------edsesgeqglsslsadlfaqslldcplsrlqlfplthccgpg
           pfqir-fep-trg caiqelsddvfml-kgsraaaqpg                               
            s-- r---rg      lmpqpsr lagskalknvlsr                               
            cgv ppsrd        gc agl g rqtleyptaae                               
              c cilha        a          h as                                    
                 a                                                              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--Ptslqtepqgnpegnhggegdscphgspqeplappaspgpfatrsp-----r-----------------drspapmsc
lrlspaedkatq-----r------l------g---l-y--ag----l-lfifm-rssllsrsssgyfsfdt-------pa
   lrqgar---tlgpa-psqsvm-dcsvte-qqr-f-hn--yrlp-speergdsdnyaaqlarsrveysaslrwlsf-l
   kama-glsdsgkhhsqapellwgathqlptptsssgh qtvwyvavwvlehhnmpsvkv cigdqmevqmpvsvpae
   gt  g- h rapwv rqr rwarvpga lrywawltr krlvsrvsltss ghleqlgt     ll egeimrrvk-
        d a atmtr dea qvi eid   drq melf eqksagqa lip  eedp  m     ce   aeepqtet
                      fr         mm hdda aper d   c     a           a     aees q
                       g          d d c   k a                               dl f
                                      a   a                                 ag  
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
dkstqtpsppcqafnhylsamasrrqaepd-m-p---------r-g----------------------------------
vlqi-eqp----w-----vqirrll---aad-r-eiriaqelr-i-defnayyarrvflnnyqaardgpqmvilrllryi
--p-g-a-selw-qhrae--l--k-gci--qfhrlpvqqhqqntnrvwwsilpflhnlalwgeenerhsvprv l  lal
lsevrr-qlwgvlrrnlmrl-vv-sesfvpsvltrhtptvretllqyrrqpsltslmskprdrtsgneagll        
rg-ssssgdqtnfyqlqtnkkttipvewtvrsewpgflrtlvgiyhwnqksnwrqwlrswpspql q qs          
ptrrhphe nrl lykings pnwirtvrrlptgnca ksgreht mhh qftqgvfq dfp ne g             
eq lamfd kfe i d gde klvgllrm g k f   hgfgdam hg  cd eaack                      
aa g h   g a a    ad gkpfdhqk e a a   f a   k f    a    ah                      
   a     c            imecdgg a               c          e                      
                      dfd                                                       
                      ce                                                        
                      a                                                         

       250       
....:....|....:..
                 
-----------------
vrlvwrmhltqlpkrcm
llplssgg hlilf   
 masqv           
 a al            
                 
                 
                 
                 
                 
                 
                 
© 1998-2019