Dataset for protein classical BH3-containing proteins of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------makqpsdvssecdregrq---lqPaerppqlrpgaptslq--------tepq--p--nhggeg---
ikfgvgsaracmfq--mee-rcve-leddv--pslfgredgedgpqdssslradapgllwda----gn-eg------ldc
           psgipef-p----d----eqg   -maspagrrasqpgkhhr-    vlgvshqteqatslfaqslaga
            c vr--srseqvpsssa-pl    l gkka-kna----g--g        gg eqtlptsshhgp e 
               cpi  atwm tqly       h ltmle---ac a-a a        ad a d gpvrdfde   
                rc    l   lic       e  rh  svv                     a d me ea    
                 a                     q   a c                         a        
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------c------gplappa--gpfatrsplfifmrrssllsrsss--fs-d-drspapmscdkstqt-psppc
plsrlqlfplds-phgspq-------sp--lg-a----g-----gv------gy--f-t--lrrea-ppavlprgeqrwe
vetssrhwyythwcgpglrptsqedkatqt--p-mqsq-valpc--teepqrlfygnagyg--l--vfgtl--iw-wqvr
i d dmassspattseeegvserasrlrlssrssahvlyasqlyarqlkrmadtmadsyrkvw-vltaerarv-rvvlra
       alrl gseddsenh ermpfkaraevgpaqtwwrgqkqqnv llqvelwrrrpdrsvspm-tq-ptl rriqt
             i   mdme d  l e q dm l nhvtefkilgkd tkprd vpqil  lsakev lthly qnhms
             e             a l  i   a ts eihdeg   h    na fk   q fdl fq he gmglk
                                a     ql aeg ae        m  ee     ead cp e   g dg
                                      dg                   a          g     f c 
                                                                            a   
                                                                                

       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
                                                                               
qafnhylsamasrrqaepad----------l------------------------------------------------
gqwrrrpevwia-k------mrpeiriaqe-rrigdewwfnayyarrlflnnyqaredhpqmvilrllryivrlvwrmh
fsrqc-aqsqvlw-lqlivsqfhrlhvqahqqnrnrvslqillflhnvakygeenangagprnhnwfs           
ygyvqv-a-lg-petvrgpevgsltvqtllssglthsltwfrglqtgms rrhtlsqfterlhckd             
vwqtpss-q--wkqspcvtttsqsssmpfscmdglalk k gfifk  e ppdhhhg p                    
sn slnmtpfwvinrnvlslsplqdqll r g       c        d   c e   e                    
rl kakfrneprglgksal llgnal     e                                               
le   i ll lnfifh    aeeh                                                       
k    f g  ckegeg                                                               
a    a     iadae                                                               
           d   c                                                               
© 1998-2018